BLASTX nr result
ID: Cinnamomum25_contig00042388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00042388 (214 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010926111.1| PREDICTED: glutamine synthetase cytosolic is... 92 1e-16 ref|XP_007032111.1| Glutamine synthase clone R1, 1,ATGLN1,1 isof... 92 1e-16 ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like ... 92 1e-16 ref|XP_010940335.1| PREDICTED: glutamine synthetase nodule isozy... 92 2e-16 ref|NP_001105296.1| glutamine synthetase root isozyme 3 [Zea may... 91 3e-16 gb|KJB10479.1| hypothetical protein B456_001G203300 [Gossypium r... 91 3e-16 gb|KJB10478.1| hypothetical protein B456_001G203300 [Gossypium r... 91 3e-16 gb|AJD14834.1| glutamine synthetase [Boehmeria nivea] 91 3e-16 ref|XP_011002191.1| PREDICTED: glutamine synthetase cytosolic is... 91 3e-16 ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic is... 91 3e-16 gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypi... 91 3e-16 ref|XP_009145973.1| PREDICTED: LOW QUALITY PROTEIN: glutamine sy... 91 3e-16 ref|XP_012086426.1| PREDICTED: glutamine synthetase cytosolic is... 91 3e-16 gb|ACA50923.1| glutamine synthetase [Zea mays] 91 3e-16 gb|EEC73954.1| hypothetical protein OsI_08842 [Oryza sativa Indi... 91 3e-16 gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] 91 3e-16 gb|AGC24234.1| glutamine synthetase 1 [Brassica napus] gi|440808... 91 3e-16 ref|XP_006406687.1| hypothetical protein EUTSA_v10021026mg [Eutr... 91 3e-16 ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic is... 91 3e-16 ref|XP_006298020.1| hypothetical protein CARUB_v10014064mg [Caps... 91 3e-16 >ref|XP_010926111.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Elaeis guineensis] Length = 357 Score = 92.0 bits (227), Expect = 1e-16 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEK+IAEYIW+GGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TEKVIAEYIWVGGSGMDIRSKARTLSGPVSDPSKLPKWNYDGS 58 >ref|XP_007032111.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma cacao] gi|508711140|gb|EOY03037.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma cacao] Length = 356 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGS 58 >ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus] gi|374676432|gb|AEZ56958.1| glutamine synthetase [Cucumis sativus] gi|700202659|gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus] Length = 356 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGS 58 >ref|XP_010940335.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis] Length = 356 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEY+WIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYVWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGS 58 >ref|NP_001105296.1| glutamine synthetase root isozyme 3 [Zea mays] gi|286124|dbj|BAA03431.1| glutamine synthetase [Zea mays] gi|194708400|gb|ACF88284.1| unknown [Zea mays] gi|308195941|gb|ADO17336.1| glutamine synthetase [Zea mays] gi|308195943|gb|ADO17337.1| glutamine synthetase [Zea mays] gi|308195945|gb|ADO17338.1| glutamine synthetase [Zea mays] gi|308195947|gb|ADO17339.1| glutamine synthetase [Zea mays] gi|413938748|gb|AFW73299.1| glutamine synthetase4 [Zea mays] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTLSGPV+DPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGS 58 >gb|KJB10479.1| hypothetical protein B456_001G203300 [Gossypium raimondii] Length = 309 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 T+KIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGS 58 >gb|KJB10478.1| hypothetical protein B456_001G203300 [Gossypium raimondii] gi|763742981|gb|KJB10480.1| hypothetical protein B456_001G203300 [Gossypium raimondii] Length = 259 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 T+KIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGS 58 >gb|AJD14834.1| glutamine synthetase [Boehmeria nivea] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTL+GPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLNGPVSDPSKLPKWNYDGS 58 >ref|XP_011002191.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Populus euphratica] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEY+WIGGSGMD+RSKARTLSGPVSDP+KLPKWNYDGS Sbjct: 16 TEKIIAEYLWIGGSGMDIRSKARTLSGPVSDPAKLPKWNYDGS 58 >ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus euphratica] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIW+GGSGMD+RSK RTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWVGGSGMDIRSKGRTLSGPVSDPSKLPKWNYDGS 58 >gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 T+KIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGS 58 >ref|XP_009145973.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase cytosolic isozyme 1-3-like [Brassica rapa] Length = 354 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTL GPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGS 58 >ref|XP_012086426.1| PREDICTED: glutamine synthetase cytosolic isozyme [Jatropha curcas] gi|643712534|gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 T+KIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGS 58 >gb|ACA50923.1| glutamine synthetase [Zea mays] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTLSGPV+DPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGS 58 >gb|EEC73954.1| hypothetical protein OsI_08842 [Oryza sativa Indica Group] Length = 364 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTLSGPV+DPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGS 58 >gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 T+KIIAEYIWIGGSGMD+RSKARTLSGPVSDPSKLPKWNYDGS Sbjct: 16 TDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGS 58 >gb|AGC24234.1| glutamine synthetase 1 [Brassica napus] gi|440808124|gb|AGC24236.1| glutamine synthetase 1 [Brassica napus] gi|674937547|emb|CDX95818.1| BnaC05g35690D [Brassica napus] gi|674941193|emb|CDX92165.1| BnaA05g22420D [Brassica napus] Length = 354 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTL GPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGS 58 >ref|XP_006406687.1| hypothetical protein EUTSA_v10021026mg [Eutrema salsugineum] gi|557107833|gb|ESQ48140.1| hypothetical protein EUTSA_v10021026mg [Eutrema salsugineum] Length = 354 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTL GPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGS 58 >ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Setaria italica] Length = 356 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTLSGPV+DPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGS 58 >ref|XP_006298020.1| hypothetical protein CARUB_v10014064mg [Capsella rubella] gi|482566729|gb|EOA30918.1| hypothetical protein CARUB_v10014064mg [Capsella rubella] Length = 354 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 131 TEKIIAEYIWIGGSGMDVRSKARTLSGPVSDPSKLPKWNYDGS 3 TEKIIAEYIWIGGSGMD+RSKARTL GPVSDPSKLPKWNYDGS Sbjct: 16 TEKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGS 58