BLASTX nr result
ID: Cinnamomum25_contig00041987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041987 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007036554.1| Associated molecule with the SH3 domain of S... 71 3e-10 ref|XP_010264320.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 68 2e-09 ref|XP_010094734.1| AMSH-like ubiquitin thioesterase 1 [Morus no... 67 6e-09 ref|XP_010549118.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_009777131.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_009777130.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_009596444.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_009596443.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 emb|CDO98423.1| unnamed protein product [Coffea canephora] 67 6e-09 ref|XP_008240248.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_006341590.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_006374181.1| hypothetical protein POPTR_0015s03810g [Popu... 67 6e-09 ref|XP_002321479.2| mov34 family protein [Populus trichocarpa] g... 67 6e-09 ref|XP_007209987.1| hypothetical protein PRUPE_ppa005186mg [Prun... 67 6e-09 ref|XP_004235758.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_002278560.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 67 6e-09 ref|XP_009380292.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 66 8e-09 ref|XP_008797799.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 66 8e-09 ref|XP_012488423.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 65 2e-08 ref|XP_012486434.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 65 2e-08 >ref|XP_007036554.1| Associated molecule with the SH3 domain of STAM 1 isoform 3 [Theobroma cacao] gi|508773799|gb|EOY21055.1| Associated molecule with the SH3 domain of STAM 1 isoform 3 [Theobroma cacao] Length = 540 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 191 LFFAQCQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 LFF +CQTTNEEEIF+VQDK+SLFPLGWIHTHPT Sbjct: 415 LFFMKCQTTNEEEIFEVQDKKSLFPLGWIHTHPT 448 >ref|XP_010264320.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Nelumbo nucifera] Length = 511 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT Sbjct: 391 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 419 >ref|XP_010094734.1| AMSH-like ubiquitin thioesterase 1 [Morus notabilis] gi|587867502|gb|EXB56899.1| AMSH-like ubiquitin thioesterase 1 [Morus notabilis] Length = 474 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 188 FFAQCQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 F QCQTTNEE+IF+VQDK+SLFPLGWIHTHPT Sbjct: 350 FSDQCQTTNEEDIFEVQDKRSLFPLGWIHTHPT 382 >ref|XP_010549118.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Tarenaya hassleriana] Length = 517 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 397 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 425 >ref|XP_009777131.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X2 [Nicotiana sylvestris] Length = 516 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 396 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 424 >ref|XP_009777130.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X1 [Nicotiana sylvestris] Length = 519 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 399 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 427 >ref|XP_009596444.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X2 [Nicotiana tomentosiformis] Length = 515 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 395 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 423 >ref|XP_009596443.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X1 [Nicotiana tomentosiformis] Length = 518 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 398 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 426 >emb|CDO98423.1| unnamed protein product [Coffea canephora] Length = 522 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 402 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 430 >ref|XP_008240248.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Prunus mume] Length = 507 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 387 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 415 >ref|XP_006341590.1| PREDICTED: AMSH-like ubiquitin thioesterase 1-like [Solanum tuberosum] Length = 516 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 396 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 424 >ref|XP_006374181.1| hypothetical protein POPTR_0015s03810g [Populus trichocarpa] gi|550321882|gb|ERP51978.1| hypothetical protein POPTR_0015s03810g [Populus trichocarpa] Length = 503 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 383 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 411 >ref|XP_002321479.2| mov34 family protein [Populus trichocarpa] gi|550321881|gb|EEF05606.2| mov34 family protein [Populus trichocarpa] Length = 505 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 383 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 411 >ref|XP_007209987.1| hypothetical protein PRUPE_ppa005186mg [Prunus persica] gi|462405722|gb|EMJ11186.1| hypothetical protein PRUPE_ppa005186mg [Prunus persica] Length = 473 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 353 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 381 >ref|XP_004235758.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Solanum lycopersicum] Length = 516 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 396 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 424 >ref|XP_002278560.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Vitis vinifera] gi|297734223|emb|CBI15470.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDKQSLFPLGWIHTHPT Sbjct: 386 CQTTNEEEIFEVQDKQSLFPLGWIHTHPT 414 >ref|XP_009380292.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Musa acuminata subsp. malaccensis] Length = 507 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIFD QDKQSLFPLGWIHTHPT Sbjct: 387 CQTTNEEEIFDYQDKQSLFPLGWIHTHPT 415 >ref|XP_008797799.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Phoenix dactylifera] Length = 513 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIFD QDKQSLFPLGWIHTHPT Sbjct: 393 CQTTNEEEIFDYQDKQSLFPLGWIHTHPT 421 >ref|XP_012488423.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X1 [Gossypium raimondii] Length = 505 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDK+SLFPLGWIHTHPT Sbjct: 385 CQTTNEEEIFEVQDKRSLFPLGWIHTHPT 413 >ref|XP_012486434.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X3 [Gossypium raimondii] Length = 463 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 176 CQTTNEEEIFDVQDKQSLFPLGWIHTHPT 90 CQTTNEEEIF+VQDK+SLFPLGWIHTHPT Sbjct: 343 CQTTNEEEIFEVQDKKSLFPLGWIHTHPT 371