BLASTX nr result
ID: Cinnamomum25_contig00041980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041980 (335 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006833223.1| PREDICTED: copper-transporting ATPase 2 [Amb... 57 6e-06 >ref|XP_006833223.1| PREDICTED: copper-transporting ATPase 2 [Amborella trichopoda] gi|548837874|gb|ERM98501.1| hypothetical protein AMTR_s00072p00184150 [Amborella trichopoda] Length = 285 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -1 Query: 335 EKKTEEGASENKVVVEPHIDYWGYGYYGPIEYVHAPQYFSDENPNACSVM 186 E K E+ ++ KVVV ++Y+GYG IEYVHAPQ FSDENPNACS+M Sbjct: 239 EAKKEDPST--KVVVNK-MEYYGYGPGYSIEYVHAPQIFSDENPNACSIM 285