BLASTX nr result
ID: Cinnamomum25_contig00041797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041797 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009770640.1| PREDICTED: blue-light photoreceptor PHR2 [Ni... 37 1e-05 >ref|XP_009770640.1| PREDICTED: blue-light photoreceptor PHR2 [Nicotiana sylvestris] Length = 456 Score = 37.0 bits (84), Expect(3) = 1e-05 Identities = 17/27 (62%), Positives = 23/27 (85%) Frame = -1 Query: 157 ESIVNLRHSLQSRSSDLIVRIGCSESV 77 ES+ +LR++LQSR SDL+VRIG E+V Sbjct: 179 ESVTDLRNNLQSRGSDLVVRIGKPETV 205 Score = 32.3 bits (72), Expect(3) = 1e-05 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -3 Query: 101 PDRVLGEREIKLAKVVSAEAVYLQREVSRDKVR 3 P+ VL +++AK V AEAVY REVS D+V+ Sbjct: 202 PETVL----VEIAKAVGAEAVYAHREVSYDEVK 230 Score = 25.4 bits (54), Expect(3) = 1e-05 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 222 HANSLSLLPLFCLDP 178 H S+S+LP++C DP Sbjct: 142 HNESMSVLPVYCFDP 156