BLASTX nr result
ID: Cinnamomum25_contig00041536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041536 (264 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007677214.1| glycosyltransferase family 20 protein [Baudo... 59 1e-06 ref|XP_007783233.1| alpha,alpha-trehalose-phosphate synthase [Co... 59 2e-06 gb|EME42152.1| glycosyltransferase family 20 protein [Dothistrom... 58 2e-06 gb|KJX97381.1| alpha-trehalose-phosphate synthase like protein [... 57 5e-06 ref|XP_003851657.1| hypothetical protein MYCGRDRAFT_86672 [Zymos... 57 5e-06 gb|EMF13011.1| glycosyltransferase family 20 protein [Sphaerulin... 57 6e-06 >ref|XP_007677214.1| glycosyltransferase family 20 protein [Baudoinia compniacensis UAMH 10762] gi|449299878|gb|EMC95891.1| glycosyltransferase family 20 protein [Baudoinia compniacensis UAMH 10762] Length = 533 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 95 STKGRLLLVSNRLPITIKRSEEGNYDFTMSS 3 S KGRLLL+SNRLPITIKRSEEGNYDF+MSS Sbjct: 10 SPKGRLLLISNRLPITIKRSEEGNYDFSMSS 40 >ref|XP_007783233.1| alpha,alpha-trehalose-phosphate synthase [Coniosporium apollinis CBS 100218] gi|494831461|gb|EON67916.1| alpha,alpha-trehalose-phosphate synthase [Coniosporium apollinis CBS 100218] Length = 539 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 110 ASSDESTKGRLLLVSNRLPITIKRSEEGNYDFTMSS 3 A +D ++GRLLL+SNRLPITIKRSEEG YDF+MSS Sbjct: 4 ADADPKSEGRLLLISNRLPITIKRSEEGKYDFSMSS 39 >gb|EME42152.1| glycosyltransferase family 20 protein [Dothistroma septosporum NZE10] Length = 529 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 95 STKGRLLLVSNRLPITIKRSEEGNYDFTMSS 3 S KGRLLL+SNRLPITIKRS+EGNYDF+MSS Sbjct: 9 SPKGRLLLISNRLPITIKRSDEGNYDFSMSS 39 >gb|KJX97381.1| alpha-trehalose-phosphate synthase like protein [Zymoseptoria brevis] Length = 560 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/39 (76%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = -2 Query: 113 MASSDEST--KGRLLLVSNRLPITIKRSEEGNYDFTMSS 3 M S DE+ KGRLLLVSNRLPITIKRS+EG+YDF+MSS Sbjct: 1 MPSFDEAPLPKGRLLLVSNRLPITIKRSDEGHYDFSMSS 39 >ref|XP_003851657.1| hypothetical protein MYCGRDRAFT_86672 [Zymoseptoria tritici IPO323] gi|339471537|gb|EGP86633.1| hypothetical protein MYCGRDRAFT_86672 [Zymoseptoria tritici IPO323] Length = 517 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/39 (76%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = -2 Query: 113 MASSDEST--KGRLLLVSNRLPITIKRSEEGNYDFTMSS 3 M S DE+ KGRLLLVSNRLPITIKRS+EG+YDF+MSS Sbjct: 1 MPSFDEAPLPKGRLLLVSNRLPITIKRSDEGHYDFSMSS 39 >gb|EMF13011.1| glycosyltransferase family 20 protein [Sphaerulina musiva SO2202] Length = 539 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 89 KGRLLLVSNRLPITIKRSEEGNYDFTMSS 3 KGRLLL+SNRLPITIKRS+EG+YDFTMSS Sbjct: 11 KGRLLLISNRLPITIKRSDEGHYDFTMSS 39