BLASTX nr result
ID: Cinnamomum25_contig00041270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041270 (461 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Ambore... 90 7e-16 gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Ambore... 80 4e-13 >gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Amborella trichopoda] Length = 131 Score = 89.7 bits (221), Expect = 7e-16 Identities = 46/62 (74%), Positives = 47/62 (75%) Frame = +2 Query: 269 PSGVTFNT*CYVHAVIFYLSKSTTLYVVYVWGGRCGREVPHFDSRPVSISDPR*RITPLG 448 PS VT T CYVHAVI L KS T YVV VWG RCGREVP F+S PVSISDPR RIT LG Sbjct: 23 PSRVTLVTFCYVHAVILSLPKSITPYVVAVWGDRCGREVPQFNSHPVSISDPRSRITRLG 82 Query: 449 LF 454 LF Sbjct: 83 LF 84 >gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = -3 Query: 267 SK*SKAENCCSLERRSAEVVPTIEVRVWD*AFRMIKTNKFFVSLVEPTPISY 112 S+ SKAENCCSLER S E +PT EVRVWD AF+MIKT KFFVSL+EP ISY Sbjct: 60 SQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIKTQKFFVSLIEPMQISY 111