BLASTX nr result
ID: Cinnamomum25_contig00041266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00041266 (386 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIY65206.1| hypothetical protein CYLTODRAFT_456531 [Cylindrob... 107 3e-21 >gb|KIY65206.1| hypothetical protein CYLTODRAFT_456531 [Cylindrobasidium torrendii FP15055 ss-10] Length = 80 Score = 107 bits (267), Expect = 3e-21 Identities = 42/63 (66%), Positives = 50/63 (79%) Frame = -1 Query: 383 EPNMLLERQTDCSVYGEYEPYTGPCEYENCGASGKNCKQTGWSGCVVYPNFNCPAQGCAC 204 E ++L+ + DCSVYG+Y YTGPCE NCGA G NC TGWSGCVVYP+F+CPAQGC C Sbjct: 18 EASVLVAERADCSVYGDYPEYTGPCELTNCGAKGTNCDATGWSGCVVYPSFDCPAQGCTC 77 Query: 203 TNY 195 T+Y Sbjct: 78 TDY 80