BLASTX nr result
ID: Cinnamomum25_contig00040795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00040795 (239 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE08102.1| antigenic cell wall galactomannoprotein [Ophiosto... 56 8e-06 >gb|EPE08102.1| antigenic cell wall galactomannoprotein [Ophiostoma piceae UAMH 11346] Length = 177 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = +3 Query: 6 IVLVVLKITQGNANDYSDAVIAKIPASLQPTAENLVAPIDDAFNQAIAVYS 158 +VL+ LK + ++D S+A++AK+PA+LQ A+NLVAPID +FN AI YS Sbjct: 122 VVLLDLKAQKAASDDMSNAIVAKVPAALQGIAQNLVAPIDASFNLAIDAYS 172