BLASTX nr result
ID: Cinnamomum25_contig00040571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00040571 (295 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKH61411.1| nonexpressor of pathogenesis-related protein 1-li... 87 4e-15 ref|XP_010277606.1| PREDICTED: regulatory protein NPR5-like [Nel... 86 7e-15 ref|XP_010273271.1| PREDICTED: regulatory protein NPR5-like [Nel... 86 7e-15 gb|AKH61409.1| nonexpressor of pathogenesis-related protein 1-li... 84 3e-14 ref|XP_009615711.1| PREDICTED: regulatory protein NPR5-like [Nic... 82 2e-13 gb|AFK30389.1| BOP3 [Nicotiana tabacum] 82 2e-13 emb|CDP14213.1| unnamed protein product [Coffea canephora] 81 3e-13 ref|XP_007162101.1| hypothetical protein PHAVU_001G124100g [Phas... 81 3e-13 gb|AGO64649.1| blade-on-petiole [Lupinus luteus] 81 3e-13 gb|AEM62768.1| BTB/POZ ankyrin repeat protein [Lotus japonicus] 81 3e-13 ref|XP_011027294.1| PREDICTED: regulatory protein NPR5 [Populus ... 80 4e-13 ref|XP_002531503.1| aberrant large forked product, putative [Ric... 80 4e-13 ref|XP_002308905.1| ankyrin repeat family protein [Populus trich... 80 4e-13 ref|XP_010056313.1| PREDICTED: regulatory protein NPR5 [Eucalypt... 80 5e-13 ref|XP_010672970.1| PREDICTED: regulatory protein NPR5-like [Bet... 80 7e-13 ref|XP_011033137.1| PREDICTED: regulatory protein NPR5-like isof... 79 9e-13 ref|XP_011033136.1| PREDICTED: regulatory protein NPR5-like isof... 79 9e-13 ref|XP_009784747.1| PREDICTED: regulatory protein NPR5-like [Nic... 79 9e-13 ref|XP_002323261.1| ankyrin repeat family protein [Populus trich... 79 9e-13 ref|XP_006605205.1| PREDICTED: regulatory protein NPR5-like [Gly... 79 9e-13 >gb|AKH61411.1| nonexpressor of pathogenesis-related protein 1-like 5 protein [Persea americana var. drymifolia] Length = 489 Score = 87.0 bits (214), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI Sbjct: 1 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 42 >ref|XP_010277606.1| PREDICTED: regulatory protein NPR5-like [Nelumbo nucifera] Length = 491 Score = 86.3 bits (212), Expect = 7e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_010273271.1| PREDICTED: regulatory protein NPR5-like [Nelumbo nucifera] Length = 488 Score = 86.3 bits (212), Expect = 7e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >gb|AKH61409.1| nonexpressor of pathogenesis-related protein 1-like 3 protein [Persea americana var. drymifolia] Length = 476 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEG +VHAHRCI Sbjct: 1 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGHLVHAHRCI 42 >ref|XP_009615711.1| PREDICTED: regulatory protein NPR5-like [Nicotiana tomentosiformis] Length = 488 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS KSLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >gb|AFK30389.1| BOP3 [Nicotiana tabacum] Length = 488 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS KSLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >emb|CDP14213.1| unnamed protein product [Coffea canephora] Length = 475 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M+LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_007162101.1| hypothetical protein PHAVU_001G124100g [Phaseolus vulgaris] gi|561035565|gb|ESW34095.1| hypothetical protein PHAVU_001G124100g [Phaseolus vulgaris] Length = 475 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M+LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >gb|AGO64649.1| blade-on-petiole [Lupinus luteus] Length = 486 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M+LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >gb|AEM62768.1| BTB/POZ ankyrin repeat protein [Lotus japonicus] Length = 483 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M+LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_011027294.1| PREDICTED: regulatory protein NPR5 [Populus euphratica] Length = 481 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_002531503.1| aberrant large forked product, putative [Ricinus communis] gi|223528890|gb|EEF30890.1| aberrant large forked product, putative [Ricinus communis] Length = 491 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_002308905.1| ankyrin repeat family protein [Populus trichocarpa] gi|222854881|gb|EEE92428.1| ankyrin repeat family protein [Populus trichocarpa] Length = 481 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_010056313.1| PREDICTED: regulatory protein NPR5 [Eucalyptus grandis] gi|629125649|gb|KCW90074.1| hypothetical protein EUGRSUZ_A02268 [Eucalyptus grandis] Length = 488 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M++EDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSIEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_010672970.1| PREDICTED: regulatory protein NPR5-like [Beta vulgaris subsp. vulgaris] gi|870863993|gb|KMT15126.1| hypothetical protein BVRB_3g062440 [Beta vulgaris subsp. vulgaris] Length = 498 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M+L+DS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSLDDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_011033137.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Populus euphratica] Length = 443 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS ++LSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_011033136.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Populus euphratica] gi|743938810|ref|XP_011013844.1| PREDICTED: regulatory protein NPR5-like [Populus euphratica] gi|743938812|ref|XP_011013845.1| PREDICTED: regulatory protein NPR5-like [Populus euphratica] gi|743943251|ref|XP_011016127.1| PREDICTED: regulatory protein NPR5-like [Populus euphratica] Length = 443 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS ++LSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_009784747.1| PREDICTED: regulatory protein NPR5-like [Nicotiana sylvestris] Length = 490 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAH+CI Sbjct: 1 MTLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHKCI 42 >ref|XP_002323261.1| ankyrin repeat family protein [Populus trichocarpa] gi|222867891|gb|EEF05022.1| ankyrin repeat family protein [Populus trichocarpa] Length = 443 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M LEDS ++LSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MTLEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42 >ref|XP_006605205.1| PREDICTED: regulatory protein NPR5-like [Glycine max] Length = 433 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 127 MNLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCI 2 M+LE+S +SLSLDYLNLLINGQAFSDVTFSVEGR+VHAHRCI Sbjct: 1 MSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI 42