BLASTX nr result
ID: Cinnamomum25_contig00039422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00039422 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096090.1| hypothetical protein L484_012445 [Morus nota... 57 5e-06 >ref|XP_010096090.1| hypothetical protein L484_012445 [Morus notabilis] gi|587874102|gb|EXB63255.1| hypothetical protein L484_012445 [Morus notabilis] Length = 180 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/95 (37%), Positives = 50/95 (52%), Gaps = 5/95 (5%) Frame = -2 Query: 336 NASEVLVPKQSSYRVCPYVSSTCATLSPSVKIPGDFSLARDSLSLERRTKVEETRGEGME 157 N E + +QS R+CP C +P AR+S+S+E+ KV+E E Sbjct: 89 NGGEYNIFRQSLKRICPPFREDCVDFTPK---------ARESVSIEKLLKVDEEVIHSGE 139 Query: 156 T-----SKSQSGKLKKRVSFRLPEEADTIFY*SPE 67 T S SQSGK++KRVSF+ P EAD I + S + Sbjct: 140 TDVSSISGSQSGKVRKRVSFKFPSEADIIIFYSSD 174