BLASTX nr result
ID: Cinnamomum25_contig00039353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00039353 (298 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010254237.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_012474396.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 ref|XP_007013756.1| Pentatricopeptide repeat (PPR) superfamily p... 100 5e-19 ref|XP_007013754.1| Pentatricopeptide repeat superfamily protein... 100 5e-19 ref|XP_007013753.1| Pentatricopeptide repeat superfamily protein... 100 5e-19 ref|XP_004498635.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_011459843.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_008343880.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_006399632.1| hypothetical protein EUTSA_v10013015mg [Eutr... 97 6e-18 ref|XP_009351090.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_009372943.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_011019735.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_010109035.1| hypothetical protein L484_007369 [Morus nota... 95 2e-17 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_003588687.1| Pentatricopeptide repeat-containing protein ... 95 2e-17 gb|KHG18640.1| hypothetical protein F383_26294 [Gossypium arboreum] 94 3e-17 ref|XP_008219858.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 emb|CDX97091.1| BnaC09g45340D [Brassica napus] 94 4e-17 ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Popu... 94 5e-17 ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prun... 94 5e-17 >ref|XP_010254237.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial isoform X1 [Nelumbo nucifera] Length = 612 Score = 102 bits (254), Expect = 1e-19 Identities = 46/97 (47%), Positives = 72/97 (74%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L++ + +SPKP++TL+ WA ++P++ T +FNS +D+LAKAR FD WSL++ L Sbjct: 120 LLEAIFNHLDYSPKPLYTLFRWAEHQPSYCSTTPVFNSMIDILAKAREFDLVWSLMLECL 179 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 ++ N++ S +S DTF +L+RRYAR+ PQA+IRTF+F Sbjct: 180 NS-NVNPSLISSDTFAILMRRYARADMPQASIRTFEF 215 >ref|XP_012474396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Gossypium raimondii] gi|763756368|gb|KJB23699.1| hypothetical protein B456_004G110500 [Gossypium raimondii] Length = 592 Score = 101 bits (252), Expect = 2e-19 Identities = 47/97 (48%), Positives = 66/97 (68%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + + SPK +H L+LWA KP F + +LFNS +++L KAR F+ AW+L++ + Sbjct: 99 LVQAIFERFDSSPKLLHNLFLWAEKKPGFESSATLFNSMINILGKARKFEDAWTLVLDRI 158 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 S+ VSV+TF +LIRRYARSG Q AIRTF+F Sbjct: 159 DVGKEDSNLVSVNTFIILIRRYARSGMTQPAIRTFEF 195 >ref|XP_007013756.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|590579336|ref|XP_007013758.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784119|gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784121|gb|EOY31377.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 560 Score = 100 bits (248), Expect = 5e-19 Identities = 48/97 (49%), Positives = 67/97 (69%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + + SPK +H L+LWA KP F + +LF+S V++L KAR F+ AWSL++ + Sbjct: 63 LLQAIFECFDSSPKLLHHLFLWAEKKPGFKSSATLFDSMVNVLGKARGFEDAWSLVLDRI 122 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 S+ VSV+TF +LIRRYAR+G PQ AIRTF+F Sbjct: 123 GDGMEGSTLVSVNTFVILIRRYARAGMPQPAIRTFEF 159 >ref|XP_007013754.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] gi|508784117|gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] Length = 584 Score = 100 bits (248), Expect = 5e-19 Identities = 48/97 (49%), Positives = 67/97 (69%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + + SPK +H L+LWA KP F + +LF+S V++L KAR F+ AWSL++ + Sbjct: 87 LLQAIFECFDSSPKLLHHLFLWAEKKPGFKSSATLFDSMVNVLGKARGFEDAWSLVLDRI 146 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 S+ VSV+TF +LIRRYAR+G PQ AIRTF+F Sbjct: 147 GDGMEGSTLVSVNTFVILIRRYARAGMPQPAIRTFEF 183 >ref|XP_007013753.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590579326|ref|XP_007013755.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590579333|ref|XP_007013757.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784116|gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784118|gb|EOY31374.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784120|gb|EOY31376.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 595 Score = 100 bits (248), Expect = 5e-19 Identities = 48/97 (49%), Positives = 67/97 (69%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + + SPK +H L+LWA KP F + +LF+S V++L KAR F+ AWSL++ + Sbjct: 98 LLQAIFECFDSSPKLLHHLFLWAEKKPGFKSSATLFDSMVNVLGKARGFEDAWSLVLDRI 157 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 S+ VSV+TF +LIRRYAR+G PQ AIRTF+F Sbjct: 158 GDGMEGSTLVSVNTFVILIRRYARAGMPQPAIRTFEF 194 >ref|XP_004498635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Cicer arietinum] Length = 596 Score = 98.6 bits (244), Expect = 1e-18 Identities = 46/99 (46%), Positives = 67/99 (67%), Gaps = 2/99 (2%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L++ + SPK +H+L+LWA +P F P P+LF+S V+ LAK + FDSAW+L++ + Sbjct: 104 LLRAVFDHFASSPKLLHSLFLWADKQPGFKPDPTLFDSMVNALAKIKEFDSAWTLVLDRI 163 Query: 113 HTQNLSSSP--VSVDTFTVLIRRYARSGSPQAAIRTFDF 3 H + VS+ TF +LIRRYAR+G +AAIRTF+F Sbjct: 164 HREEEEKEDKLVSIGTFAILIRRYARAGMHEAAIRTFEF 202 >ref|XP_011459843.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Fragaria vesca subsp. vesca] Length = 591 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/98 (45%), Positives = 66/98 (67%) Frame = -3 Query: 296 SLIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPH 117 SL+Q + SPK +HTL++WA +P F + LF S +++LAKAR F+SAWS+++ Sbjct: 98 SLVQAVFDHFDSSPKLLHTLFVWAEEQPGFRCSVKLFTSVINVLAKAREFESAWSMILDR 157 Query: 116 LHTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 + + VSVD F ++IRRYAR+G PQ+AIR F+F Sbjct: 158 IGGDK-EAGLVSVDAFVIMIRRYARAGQPQSAIRAFEF 194 >ref|XP_008343880.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Malus domestica] gi|658017046|ref|XP_008343881.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Malus domestica] gi|658017048|ref|XP_008343883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Malus domestica] Length = 604 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/97 (46%), Positives = 64/97 (65%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + SPK +HTL+LWA +P F + LF S +++LAK+R FDSAWSL++ + Sbjct: 112 LVQAVFDHFDSSPKLLHTLFLWAEKQPGFRSSAKLFGSVINVLAKSREFDSAWSLILNRI 171 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 VS DTF ++IRRY R+G P++AIRTF+F Sbjct: 172 GGDE-EPGLVSADTFVIMIRRYTRAGMPESAIRTFEF 207 >ref|XP_006399632.1| hypothetical protein EUTSA_v10013015mg [Eutrema salsugineum] gi|557100722|gb|ESQ41085.1| hypothetical protein EUTSA_v10013015mg [Eutrema salsugineum] Length = 603 Score = 96.7 bits (239), Expect = 6e-18 Identities = 48/97 (49%), Positives = 63/97 (64%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 LIQ L + SP +H+L+ WA KP F P+PS+F+S ++ L KAR F+ AWSL+ + Sbjct: 105 LIQALFDRLRSSPMLLHSLFKWAEMKPGFTPSPSMFDSVINALCKAREFEIAWSLIFDRV 164 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 + S VS DTF VLIRRYAR+G Q AIR F+F Sbjct: 165 RSDG-GSDLVSADTFVVLIRRYARAGMVQQAIRAFEF 200 >ref|XP_009351090.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452173|ref|XP_009351091.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452176|ref|XP_009351092.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452180|ref|XP_009351093.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] Length = 608 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/97 (46%), Positives = 64/97 (65%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + SPK +HTL+LWA +P F + LF S +++LAK+R FDSAWSL++ + Sbjct: 116 LVQAVFDHFDSSPKLLHTLFLWAEKQPGFRSSAKLFGSMINVLAKSREFDSAWSLILNRV 175 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 VS DTF ++IRRY R+G P++AIRTF+F Sbjct: 176 GGDE-EPGLVSADTFVIMIRRYTRAGMPESAIRTFEF 211 >ref|XP_009372943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] Length = 608 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/97 (46%), Positives = 64/97 (65%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + SPK +HTL+LWA +P F + LF S +++LAK+R FDSAWSL++ + Sbjct: 116 LVQAVFDHFDSSPKLLHTLFLWAEKQPGFRSSAKLFGSMINVLAKSREFDSAWSLILNRV 175 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 VS DTF ++IRRY R+G P++AIRTF+F Sbjct: 176 GGDE-GPGLVSADTFVIMIRRYTRAGMPESAIRTFEF 211 >ref|XP_011019735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Populus euphratica] Length = 607 Score = 95.1 bits (235), Expect = 2e-17 Identities = 47/97 (48%), Positives = 65/97 (67%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + SPK +H+++LWA KP F + +LFNS V+LL KAR F SAW LL+ + Sbjct: 115 LLQAVFDHFDSSPKLLHSVFLWAEKKPGFQSSAALFNSMVNLLGKAREFGSAWCLLLDKI 174 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 N + VS DTF +LIRRYAR+G +AA+RTF++ Sbjct: 175 -GGNEGGNLVSSDTFAILIRRYARAGMSEAAVRTFEY 210 >ref|XP_010109035.1| hypothetical protein L484_007369 [Morus notabilis] gi|587933833|gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] Length = 612 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 2/100 (2%) Frame = -3 Query: 296 SLIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPH 117 SL+Q + SPK +++L+LWA +P + + SLF S +++LAK+R FDSAWSL+ Sbjct: 122 SLLQAVFDHFDSSPKLLYSLFLWAEKQPGYRSSASLFASVINVLAKSREFDSAWSLI--- 178 Query: 116 LHTQNLSSSP--VSVDTFTVLIRRYARSGSPQAAIRTFDF 3 LH P V DTF ++IRRYAR G PQ+A+RTF+F Sbjct: 179 LHRIGKEEEPRLVCEDTFVIMIRRYAREGMPQSAVRTFEF 218 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Cucumis sativus] gi|700204990|gb|KGN60123.1| hypothetical protein Csa_3G878910 [Cucumis sativus] Length = 615 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/98 (47%), Positives = 66/98 (67%) Frame = -3 Query: 296 SLIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPH 117 SL++ + SPK +H+L+LWA+ K F P+ +LFN +++LAK+R FDSAWSL+ Sbjct: 121 SLLEAVFDHFDSSPKFLHSLFLWAAKKSGFRPSAALFNRLINVLAKSREFDSAWSLITSR 180 Query: 116 LHTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 L S VSV+ F +LIRRYAR+G Q AIRT++F Sbjct: 181 LRGGE-ESFLVSVEVFVILIRRYARAGMVQPAIRTYEF 217 >ref|XP_003588687.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477735|gb|AES58938.1| PPR containing plant-like protein [Medicago truncatula] Length = 587 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/98 (46%), Positives = 64/98 (65%), Gaps = 1/98 (1%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+ + SPK +H+LYLWA N+P F P SLF+S ++ LAK + FD AWSL++ + Sbjct: 106 LLHAVFDHFASSPKLLHSLYLWALNQPGFKPDSSLFDSVINALAKMKEFDDAWSLVLDRI 165 Query: 113 HTQNLSSSP-VSVDTFTVLIRRYARSGSPQAAIRTFDF 3 + VSV TF ++IRRYAR+G +AAIRTF+F Sbjct: 166 RRDDDDDEKLVSVGTFAIIIRRYARAGMHKAAIRTFEF 203 >gb|KHG18640.1| hypothetical protein F383_26294 [Gossypium arboreum] Length = 592 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/97 (46%), Positives = 64/97 (65%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + + SPK +H L+L A KP F + +LFNS +++L KAR F+ AW L++ + Sbjct: 99 LVQAIFERFDSSPKLLHNLFLCAEKKPGFESSATLFNSMINILGKARKFEDAWILVLDRI 158 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 S+ VSV+TF +LIRRYAR+G Q AIRTF+F Sbjct: 159 DVGKEGSNLVSVNTFIILIRRYARAGMTQPAIRTFEF 195 >ref|XP_008219858.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Prunus mume] gi|645226050|ref|XP_008219860.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Prunus mume] Length = 607 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/97 (45%), Positives = 65/97 (67%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + SPK +HTL+LWA +P F + +LF +++LAK+R F+SAWSL++ + Sbjct: 115 LLQAVFDHFDSSPKLLHTLFLWAQKRPGFRSSATLFGCMINVLAKSREFESAWSLILNRI 174 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 VSVDTF ++IRRY+R+G Q+AIRTF+F Sbjct: 175 GADE-EPGLVSVDTFVIMIRRYSRAGMSQSAIRTFEF 210 >emb|CDX97091.1| BnaC09g45340D [Brassica napus] Length = 586 Score = 94.0 bits (232), Expect = 4e-17 Identities = 45/97 (46%), Positives = 63/97 (64%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q L SP +H+++ WA KP F +PSLFNS ++ + KAR F+SAWSL+ + Sbjct: 99 LVQALFDRLSSSPMLLHSVFKWADTKPTFTLSPSLFNSVINAMCKARDFESAWSLIFDRV 158 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 + S V+ DTFTVLIRRYAR+G Q AI+ F++ Sbjct: 159 RSDG-GSELVTADTFTVLIRRYARAGMVQQAIKAFEY 194 >ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] gi|222854612|gb|EEE92159.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] Length = 607 Score = 93.6 bits (231), Expect = 5e-17 Identities = 47/97 (48%), Positives = 63/97 (64%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 LIQ++ SPK +H+++LWA KP F + +LFNS V+ L KAR F SAW LL+ + Sbjct: 115 LIQSVFDHFDSSPKLLHSVFLWAEKKPGFQSSAALFNSMVNFLGKAREFGSAWCLLLDRI 174 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 N VS DTF +LIRRY R+G +AAIRTF++ Sbjct: 175 -GGNEGGDLVSSDTFAILIRRYTRAGMSEAAIRTFEY 210 >ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] gi|462418970|gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/97 (45%), Positives = 65/97 (67%) Frame = -3 Query: 293 LIQTLIQSSQFSPKPIHTLYLWASNKPNFNPTPSLFNSTVDLLAKARHFDSAWSLLIPHL 114 L+Q + SPK +HTL+LWA +P F + +LF +++LAK+R F+SAWSL++ + Sbjct: 117 LLQAVFDHFDSSPKLLHTLFLWAEKRPGFRSSATLFGCMINVLAKSREFESAWSLILNRI 176 Query: 113 HTQNLSSSPVSVDTFTVLIRRYARSGSPQAAIRTFDF 3 VSVDTF ++IRRY+R+G Q+AIRTF+F Sbjct: 177 GGDE-EPGLVSVDTFVIMIRRYSRAGMSQSAIRTFEF 212