BLASTX nr result
ID: Cinnamomum25_contig00039134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00039134 (214 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251864.1| PREDICTED: putative disease resistance prote... 73 6e-11 ref|XP_012068629.1| PREDICTED: putative disease resistance prote... 65 1e-08 ref|XP_002513078.1| leucine-rich repeat-containing protein, puta... 65 1e-08 emb|CAN81660.1| hypothetical protein VITISV_006043 [Vitis vinifera] 62 1e-07 ref|XP_010245910.1| PREDICTED: putative disease resistance prote... 60 4e-07 ref|XP_010999618.1| PREDICTED: putative disease resistance prote... 60 7e-07 ref|XP_002297751.2| hypothetical protein POPTR_0001s06270g [Popu... 59 1e-06 ref|XP_002274375.1| PREDICTED: putative disease resistance RPP13... 59 2e-06 ref|XP_012478947.1| PREDICTED: putative disease resistance prote... 58 2e-06 ref|XP_009406818.1| PREDICTED: putative disease resistance RPP13... 58 3e-06 ref|XP_007045385.1| LRR and NB-ARC domains-containing disease re... 58 3e-06 ref|XP_002269779.2| PREDICTED: putative disease resistance prote... 58 3e-06 emb|CAN60801.1| hypothetical protein VITISV_022857 [Vitis vinifera] 58 3e-06 ref|XP_012448285.1| PREDICTED: putative disease resistance prote... 57 4e-06 ref|XP_006484759.1| PREDICTED: putative disease resistance prote... 57 5e-06 ref|XP_006484758.1| PREDICTED: putative disease resistance prote... 57 5e-06 ref|XP_006437330.1| hypothetical protein CICLE_v10030540mg [Citr... 57 5e-06 ref|XP_006437329.1| hypothetical protein CICLE_v10030540mg [Citr... 57 5e-06 gb|KDO49423.1| hypothetical protein CISIN_1g000962mg [Citrus sin... 57 6e-06 gb|KDO49422.1| hypothetical protein CISIN_1g000962mg [Citrus sin... 57 6e-06 >ref|XP_010251864.1| PREDICTED: putative disease resistance protein RGA1 [Nelumbo nucifera] Length = 1110 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/69 (50%), Positives = 49/69 (71%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITG 32 +TAL+EL+I C L SLSE GLQ ++SL L+I +CP L SL +++LP TL+ +I+ Sbjct: 944 LTALKELDISYCEGLRSLSENQGLQHLSSLEHLEISECPSLISLAEEVLPTTLKHFEISN 1003 Query: 31 CSNLKCLPK 5 C NL+ LPK Sbjct: 1004 CPNLRSLPK 1012 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/64 (43%), Positives = 45/64 (70%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITG 32 +++L+++EI EC +L L E G+Q++TSL++L+I+ CPQ+ S +D LP LQ L I+ Sbjct: 1017 LSSLQDIEIRECQQLEHLPE--GIQNLTSLQLLEIWGCPQILSFPEDRLPDNLQHLSISK 1074 Query: 31 CSNL 20 C L Sbjct: 1075 CPQL 1078 >ref|XP_012068629.1| PREDICTED: putative disease resistance protein RGA3 [Jatropha curcas] gi|643733670|gb|KDP40513.1| hypothetical protein JCGZ_24512 [Jatropha curcas] Length = 1100 Score = 65.5 bits (158), Expect = 1e-08 Identities = 36/70 (51%), Positives = 46/70 (65%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITG 32 +TAL+E +I RL +L EE+GL D+ SL+ L I CP+L S + LPI LQ L I+ Sbjct: 918 LTALKEFKIQHFYRLKALQEEIGLHDLQSLQHLDILCCPKLLSFAEKGLPIKLQHLSISM 977 Query: 31 CSNLKCLPKG 2 CSNLK LP G Sbjct: 978 CSNLKELPCG 987 >ref|XP_002513078.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223548089|gb|EEF49581.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1096 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = -1 Query: 214 PVTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQIT 35 P+ AL+EL+I RL +L EEVGLQD+ S++ L+I+ CP+L S + LP LQ L I Sbjct: 915 PLAALKELKIQHFYRLKALQEEVGLQDLHSVQRLEIFCCPKLESFAERGLPSMLQFLSIG 974 Query: 34 GCSNLKCLPKG 2 C+N+K LP G Sbjct: 975 MCNNMKDLPNG 985 >emb|CAN81660.1| hypothetical protein VITISV_006043 [Vitis vinifera] Length = 1372 Score = 62.0 bits (149), Expect = 1e-07 Identities = 35/73 (47%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEV-----GLQDITSLRVLKIYQCPQLTSLGDDILPITLQR 47 + +LEEL+I +C+ L++ EV GL D+TSL L I CP LTSL + LP L+R Sbjct: 1019 LASLEELKIVDCSELMAFPREVESLPEGLHDLTSLESLIIEGCPSLTSLAEMGLPAVLKR 1078 Query: 46 LQITGCSNLKCLP 8 L I C NLK LP Sbjct: 1079 LVIRKCGNLKALP 1091 >ref|XP_010245910.1| PREDICTED: putative disease resistance protein RGA3 [Nelumbo nucifera] Length = 1154 Score = 60.5 bits (145), Expect = 4e-07 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = -1 Query: 205 ALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCS 26 AL+EL+I +C L+SL+ + GLQ + SL L I+QCPQL +L D P +L L I C Sbjct: 944 ALKELDIEDCDELVSLATKEGLQSLLSLEYLVIWQCPQLETLPDG-FPTSLLYLWIRDCF 1002 Query: 25 NLKCLPKG 2 NLK +P G Sbjct: 1003 NLKSIPGG 1010 >ref|XP_010999618.1| PREDICTED: putative disease resistance protein RGA3 [Populus euphratica] Length = 1093 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = -1 Query: 205 ALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCS 26 +L+EL I RL +L EE+GL D+ SLR L+I CP+L S P+ LQ L I C+ Sbjct: 913 SLKELRIKHFYRLRTLQEELGLHDLPSLRRLEILFCPKLRSFSGKGFPLALQYLSIRACN 972 Query: 25 NLKCLPKG 2 +LK LP G Sbjct: 973 DLKDLPNG 980 >ref|XP_002297751.2| hypothetical protein POPTR_0001s06270g [Populus trichocarpa] gi|550346647|gb|EEE82556.2| hypothetical protein POPTR_0001s06270g [Populus trichocarpa] Length = 840 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/70 (44%), Positives = 44/70 (62%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITG 32 +++L+EL I RL +L EE+GL D+ SL+ L+I CP+L S P+ LQ L I Sbjct: 658 LSSLKELRIKHFYRLRTLQEELGLHDLPSLQRLEILFCPKLRSFSGKGFPLALQYLSIRA 717 Query: 31 CSNLKCLPKG 2 C++LK LP G Sbjct: 718 CNDLKDLPNG 727 >ref|XP_002274375.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] Length = 1427 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 3/73 (4%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGD---DILPITLQRLQ 41 + +LEEL+I +C+ L++ EV LQ +TSL+ L I+ CP+++SL D + LP L L+ Sbjct: 1019 LASLEELKIVDCSELMAFPREVSLQLLTSLKRLLIWNCPRISSLPDGEEEELPSELGTLE 1078 Query: 40 ITGCSNLKCLPKG 2 I C+N++ L KG Sbjct: 1079 IMDCNNIERLQKG 1091 >ref|XP_012478947.1| PREDICTED: putative disease resistance protein RGA3 [Gossypium raimondii] gi|823158145|ref|XP_012478948.1| PREDICTED: putative disease resistance protein RGA3 [Gossypium raimondii] gi|763763438|gb|KJB30692.1| hypothetical protein B456_005G155200 [Gossypium raimondii] Length = 1171 Score = 58.2 bits (139), Expect = 2e-06 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = -1 Query: 211 VTALEELEIGECTRL-LSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPIT-LQRLQI 38 +TALEELEI EC L LS E + ++ LR L+I P+L+SL D + +T L+ LQI Sbjct: 1030 LTALEELEIKECRELDLSKDLEENVMELQCLRTLRIEDMPKLSSLPDGLQHVTTLKDLQI 1089 Query: 37 TGCSNLKCLPK 5 + CSNLK LP+ Sbjct: 1090 SSCSNLKTLPE 1100 >ref|XP_009406818.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Musa acuminata subsp. malaccensis] Length = 1259 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/70 (42%), Positives = 44/70 (62%) Frame = -1 Query: 214 PVTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQIT 35 P++AL EL I C +L +L + LQ++ SL L + CP+L DD+LP TLQ L+I+ Sbjct: 1089 PLSALRELSITTCEQLSTL---MCLQNLNSLESLTLDMCPELFLNSDDVLPFTLQYLEIS 1145 Query: 34 GCSNLKCLPK 5 C+ L LP+ Sbjct: 1146 SCNKLSALPR 1155 >ref|XP_007045385.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508709320|gb|EOY01217.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 1192 Score = 57.8 bits (138), Expect = 3e-06 Identities = 39/75 (52%), Positives = 50/75 (66%), Gaps = 6/75 (8%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVG-----LQDITSLRVLKIYQCPQLTSLGDDILPIT-LQ 50 +TALEELEI EC R L LS++V L+ + SLR LKI P+L SL D + +T L+ Sbjct: 1048 LTALEELEIKEC-RELDLSKDVEENVMELRFLRSLRTLKIGDMPKLNSLPDGLQHVTTLK 1106 Query: 49 RLQITGCSNLKCLPK 5 LQI+ CSNLK LP+ Sbjct: 1107 YLQISSCSNLKSLPE 1121 >ref|XP_002269779.2| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera] Length = 1091 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/70 (42%), Positives = 46/70 (65%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITG 32 + +L+EL I RL +L +EVGLQD+ SL+ +I CP+L SL ++ L L+ L + Sbjct: 909 LNSLKELRIQNFYRLEALKKEVGLQDLVSLQRFEILSCPKLVSLPEEGLSSALRYLSLCV 968 Query: 31 CSNLKCLPKG 2 C++L+ LPKG Sbjct: 969 CNSLQSLPKG 978 >emb|CAN60801.1| hypothetical protein VITISV_022857 [Vitis vinifera] Length = 951 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/70 (42%), Positives = 46/70 (65%) Frame = -1 Query: 211 VTALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITG 32 + +L+EL I RL +L +EVGLQD+ SL+ +I CP+L SL ++ L L+ L + Sbjct: 769 LNSLKELRIQNFYRLEALKKEVGLQDLVSLQRFEILSCPKLVSLPEEGLSSALRYLSLCV 828 Query: 31 CSNLKCLPKG 2 C++L+ LPKG Sbjct: 829 CNSLQSLPKG 838 >ref|XP_012448285.1| PREDICTED: putative disease resistance protein At3g14460 [Gossypium raimondii] gi|763793286|gb|KJB60282.1| hypothetical protein B456_009G297900 [Gossypium raimondii] Length = 1418 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = -1 Query: 205 ALEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCS 26 +LE L I C +L LS + ++TSLR L+I +CP+L S D LP+TL+ L + C Sbjct: 1024 SLEHLRIKHCEKLEKLSAT--MYNLTSLRELEIVKCPKLLSFSHDNLPLTLKGLVVKNCD 1081 Query: 25 NLKCL 11 NLKCL Sbjct: 1082 NLKCL 1086 >ref|XP_006484759.1| PREDICTED: putative disease resistance protein RGA3-like isoform X2 [Citrus sinensis] Length = 1199 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -1 Query: 202 LEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCSN 23 L+ L I +C L+SLS E LQ +TSL +L I CP+L +L D+ LP +L+ L I CS+ Sbjct: 1018 LKALYIRDCKDLVSLSGEGALQSLTSLNLLSIRGCPKLETLPDEGLPTSLKCLIIVSCSS 1077 Query: 22 LKCL-PKG 2 LK L P+G Sbjct: 1078 LKSLGPRG 1085 >ref|XP_006484758.1| PREDICTED: putative disease resistance protein RGA3-like isoform X1 [Citrus sinensis] Length = 1208 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -1 Query: 202 LEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCSN 23 L+ L I +C L+SLS E LQ +TSL +L I CP+L +L D+ LP +L+ L I CS+ Sbjct: 1018 LKALYIRDCKDLVSLSGEGALQSLTSLNLLSIRGCPKLETLPDEGLPTSLKCLIIVSCSS 1077 Query: 22 LKCL-PKG 2 LK L P+G Sbjct: 1078 LKSLGPRG 1085 >ref|XP_006437330.1| hypothetical protein CICLE_v10030540mg [Citrus clementina] gi|557539526|gb|ESR50570.1| hypothetical protein CICLE_v10030540mg [Citrus clementina] Length = 1208 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -1 Query: 202 LEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCSN 23 L+ L I +C L+SLS E LQ +TSL +L I CP+L +L D+ LP +L+ L I CS+ Sbjct: 1018 LKALYIRDCKDLVSLSGEGALQSLTSLNLLSIRGCPKLETLPDEGLPTSLKCLIIASCSS 1077 Query: 22 LKCL-PKG 2 LK L P+G Sbjct: 1078 LKSLGPRG 1085 >ref|XP_006437329.1| hypothetical protein CICLE_v10030540mg [Citrus clementina] gi|557539525|gb|ESR50569.1| hypothetical protein CICLE_v10030540mg [Citrus clementina] Length = 1199 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -1 Query: 202 LEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCSN 23 L+ L I +C L+SLS E LQ +TSL +L I CP+L +L D+ LP +L+ L I CS+ Sbjct: 1018 LKALYIRDCKDLVSLSGEGALQSLTSLNLLSIRGCPKLETLPDEGLPTSLKCLIIASCSS 1077 Query: 22 LKCL-PKG 2 LK L P+G Sbjct: 1078 LKSLGPRG 1085 >gb|KDO49423.1| hypothetical protein CISIN_1g000962mg [Citrus sinensis] gi|641830334|gb|KDO49424.1| hypothetical protein CISIN_1g000962mg [Citrus sinensis] Length = 1208 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -1 Query: 202 LEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCSN 23 L+ L I +C L+SLS E LQ +TSL +L I CP+L +L D+ LP +L+ L I CS Sbjct: 1018 LKALYIRDCKDLVSLSGEGALQSLTSLNLLSIRGCPKLETLPDEGLPTSLKCLIIASCSG 1077 Query: 22 LKCL-PKG 2 LK L P+G Sbjct: 1078 LKSLGPRG 1085 >gb|KDO49422.1| hypothetical protein CISIN_1g000962mg [Citrus sinensis] Length = 1199 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -1 Query: 202 LEELEIGECTRLLSLSEEVGLQDITSLRVLKIYQCPQLTSLGDDILPITLQRLQITGCSN 23 L+ L I +C L+SLS E LQ +TSL +L I CP+L +L D+ LP +L+ L I CS Sbjct: 1018 LKALYIRDCKDLVSLSGEGALQSLTSLNLLSIRGCPKLETLPDEGLPTSLKCLIIASCSG 1077 Query: 22 LKCL-PKG 2 LK L P+G Sbjct: 1078 LKSLGPRG 1085