BLASTX nr result
ID: Cinnamomum25_contig00038568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038568 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406289.1| PREDICTED: glucose-1-phosphate adenylyltrans... 56 8e-06 >ref|XP_009406289.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 549 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 287 YLFNDYWEDIGMIKSFLDANLALTDEVGVIIR 192 Y+FNDYWEDIG I+SF DANLALT++VG+ R Sbjct: 348 YIFNDYWEDIGTIRSFFDANLALTEQVGISFR 379