BLASTX nr result
ID: Cinnamomum25_contig00038247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038247 (390 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010675528.1| PREDICTED: uncharacterized protein LOC104891... 40 6e-06 >ref|XP_010675528.1| PREDICTED: uncharacterized protein LOC104891519 [Beta vulgaris subsp. vulgaris] Length = 1865 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 22/55 (40%), Positives = 33/55 (60%) Frame = +1 Query: 1 EIAIALNRREDGRLPSQPTVNPKNTFEVRSSSQPHDTYHEDAKIVVMLRNGREVE 165 ++A + +R+DG+LPS NPKN H+ +E AK V+ LRNG+EV+ Sbjct: 573 QLANVIGKRDDGKLPSNSIENPKN----------HN--YEQAKAVMTLRNGKEVD 615 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = +3 Query: 189 IVRESAPNPKSSRVEKSPKEKEVSPSTSSSI---PAVACIYMPKVPFPTCLDTPPPFGK 356 ++ ++ N +S ++ K + S+SSS + + Y P+VP+P LD P P+GK Sbjct: 618 VMEKNNANSNASLSKEDKTNKAIVDSSSSSNVSNSSTSIPYEPRVPYPQALDAPSPYGK 676