BLASTX nr result
ID: Cinnamomum25_contig00037894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00037894 (315 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102114.1| hypothetical protein L484_021348 [Morus nota... 60 4e-07 ref|XP_012453674.1| PREDICTED: putative pentatricopeptide repeat... 57 4e-06 ref|XP_012464407.1| PREDICTED: putative pentatricopeptide repeat... 57 6e-06 ref|XP_012464405.1| PREDICTED: putative pentatricopeptide repeat... 57 6e-06 gb|KGN54770.1| hypothetical protein Csa_4G481190 [Cucumis sativus] 56 8e-06 ref|XP_011653883.1| PREDICTED: putative pentatricopeptide repeat... 56 8e-06 >ref|XP_010102114.1| hypothetical protein L484_021348 [Morus notabilis] gi|587904163|gb|EXB92364.1| hypothetical protein L484_021348 [Morus notabilis] Length = 453 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 312 LCRVRRYRTAFRIMLACVRDGIKVLTSARRAVLDGLRSSRFYREEKK 172 LC+V+RY+ A +++L+C++DG+KVL SARRAVLDGLR S E K Sbjct: 395 LCKVKRYKCAAKLLLSCLKDGMKVLRSARRAVLDGLRGSGLIHEANK 441 >ref|XP_012453674.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium raimondii] gi|823241953|ref|XP_012453675.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium raimondii] gi|823241955|ref|XP_012453676.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium raimondii] gi|823241957|ref|XP_012453677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium raimondii] gi|823241959|ref|XP_012453678.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium raimondii] gi|763807541|gb|KJB74479.1| hypothetical protein B456_011G295800 [Gossypium raimondii] Length = 456 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 312 LCRVRRYRTAFRIMLACVRDGIKVLTSARRAVLDGLRSSRFYREEKK 172 LCR RRY +A +I+L+C+R G+K+L SA+RAVL GLR S F RE K+ Sbjct: 397 LCRDRRYHSAAKILLSCLRSGMKILKSAQRAVLLGLRYSGFPREAKR 443 >ref|XP_012464407.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X3 [Gossypium raimondii] Length = 369 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 312 LCRVRRYRTAFRIMLACVRDGIKVLTSARRAVLDGLRSSRFYREEKK 172 LCR RRY +A +++L+C+R G+K+L SA+RAVL GLR S F RE K+ Sbjct: 310 LCRDRRYHSAAKLLLSCLRSGMKILKSAQRAVLLGLRYSGFPREAKR 356 >ref|XP_012464405.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Gossypium raimondii] gi|763815387|gb|KJB82239.1| hypothetical protein B456_013G183800 [Gossypium raimondii] Length = 456 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 312 LCRVRRYRTAFRIMLACVRDGIKVLTSARRAVLDGLRSSRFYREEKK 172 LCR RRY +A +++L+C+R G+K+L SA+RAVL GLR S F RE K+ Sbjct: 397 LCRDRRYHSAAKLLLSCLRSGMKILKSAQRAVLLGLRYSGFPREAKR 443 >gb|KGN54770.1| hypothetical protein Csa_4G481190 [Cucumis sativus] Length = 446 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = -1 Query: 312 LCRVRRYRTAFRIMLACVRDGIKVLTSARRAVLDGLRSSRFYREEKK 172 LC+ RR+R A +++++C RDG+KVL + RRAV+DGL SS F E +K Sbjct: 388 LCKARRFRCASKLLISCSRDGMKVLKATRRAVIDGLCSSGFTSEARK 434 >ref|XP_011653883.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Cucumis sativus] gi|778694867|ref|XP_011653885.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Cucumis sativus] Length = 456 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = -1 Query: 312 LCRVRRYRTAFRIMLACVRDGIKVLTSARRAVLDGLRSSRFYREEKK 172 LC+ RR+R A +++++C RDG+KVL + RRAV+DGL SS F E +K Sbjct: 398 LCKARRFRCASKLLISCSRDGMKVLKATRRAVIDGLCSSGFTSEARK 444