BLASTX nr result
ID: Cinnamomum25_contig00037675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00037675 (560 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriod... 62 1e-07 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 60 5e-07 >ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] gi|480541934|gb|AGJ90427.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] Length = 554 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +3 Query: 450 SSNTAGQGSLLPSQVLAYTLCSGWPSYQNASRSFYKA 560 S A QGSLLPSQVLAY LCSG PSYQNASRSFYKA Sbjct: 263 SKPKADQGSLLPSQVLAYALCSGRPSYQNASRSFYKA 299 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +3 Query: 450 SSNTAGQGSLLPSQVLAYTLCSGWPSYQNASRSFYKA 560 S A QGSLLP QVLAY LCSG PSYQNASRSFYKA Sbjct: 265 SKPKADQGSLLPRQVLAYALCSGRPSYQNASRSFYKA 301