BLASTX nr result
ID: Cinnamomum25_contig00037488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00037488 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, he... 60 4e-07 ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, he... 58 2e-06 ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-... 58 3e-06 ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, p... 58 3e-06 emb|CDP03063.1| unnamed protein product [Coffea canephora] 56 8e-06 >ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Elaeis guineensis] Length = 747 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 143 EDEFTNSVESGLKLAKRIYSGKDRFVSPPRPVAVMDRGPAS 21 +DEF +VE GLKLAKRIY+GKDR +PPRPV M+R P S Sbjct: 3 DDEFAKAVEDGLKLAKRIYAGKDRHFAPPRPVGGMERSPVS 43 >ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Vitis vinifera] gi|297738541|emb|CBI27786.3| unnamed protein product [Vitis vinifera] Length = 756 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -1 Query: 146 MEDEFTNSVESGLKLAKRIYSGKDRFVSPPRPVAVMDRGPASRTTYLP 3 M D+FT SVE GLKLAKRIY GKDR V+PP+PV+ MD+ S +YLP Sbjct: 1 MADDFTKSVEDGLKLAKRIYFGKDRSVTPPKPVS-MDK---SSKSYLP 44 >ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-trypsin inhibitor, heavy chain 4-like [Phoenix dactylifera] Length = 746 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 143 EDEFTNSVESGLKLAKRIYSGKDRFVSPPRPVAVMDRGPAS 21 +DEF +VE GLKLAKRIY+GKDR PPRPV M+R AS Sbjct: 3 DDEFAKAVEDGLKLAKRIYAGKDRHFGPPRPVGGMERSLAS 43 >ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus communis] gi|223544740|gb|EEF46256.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus communis] Length = 755 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -1 Query: 146 MEDEFTNSVESGLKLAKRIYSGKDRFVSPPRPVAVMDRGPASRTTYLP 3 M +EF NSVE GLKL+KR+Y GKDR V+PPRPV M++ S YLP Sbjct: 1 MAEEFGNSVEDGLKLSKRLYYGKDRAVAPPRPVVHMEK---SAEAYLP 45 >emb|CDP03063.1| unnamed protein product [Coffea canephora] Length = 748 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -1 Query: 146 MEDEFTNSVESGLKLAKRIYSGKDRFVSPPRPVAVMDRGPASRTTYLP 3 M +EF +VE GL+L+KRIY GKDR V+PP+P+ MD+ P + YLP Sbjct: 1 MAEEFARAVEDGLRLSKRIYFGKDRAVAPPKPITPMDKTP--QQMYLP 46