BLASTX nr result
ID: Cinnamomum25_contig00037177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00037177 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109035.1| hypothetical protein L484_007369 [Morus nota... 77 5e-12 ref|XP_010254238.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_010254237.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_010536088.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_009788683.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-11 ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-11 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Popu... 71 3e-10 ref|XP_011019735.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_010453175.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_006399632.1| hypothetical protein EUTSA_v10013015mg [Eutr... 70 6e-10 ref|XP_009601410.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prun... 70 7e-10 ref|XP_011459843.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009351090.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009372943.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009121967.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 emb|CDX69767.1| BnaA10g21160D [Brassica napus] 69 2e-09 emb|CDX97091.1| BnaC09g45340D [Brassica napus] 69 2e-09 >ref|XP_010109035.1| hypothetical protein L484_007369 [Morus notabilis] gi|587933833|gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] Length = 612 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 DALCKEGHV AA YF ++K +P+ + S+R YNILLNG FRSRKL++AERL+ +M+ Sbjct: 240 DALCKEGHVRAASDYFNEKKKLDPSWIPSIRAYNILLNGWFRSRKLKRAERLWMEMK 296 >ref|XP_010254238.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial isoform X2 [Nelumbo nucifera] Length = 437 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGH A +Y QRK EP + ++RVYNILLNG FRSRKL++AERL+E MR Sbjct: 62 DSLCKEGHARIASAYLDQRKQLEPGWIPTIRVYNILLNGWFRSRKLKQAERLWEVMR 118 >ref|XP_010254237.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial isoform X1 [Nelumbo nucifera] Length = 612 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGH A +Y QRK EP + ++RVYNILLNG FRSRKL++AERL+E MR Sbjct: 237 DSLCKEGHARIASAYLDQRKQLEPGWIPTIRVYNILLNGWFRSRKLKQAERLWEVMR 293 >ref|XP_010536088.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Tarenaya hassleriana] Length = 594 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/57 (61%), Positives = 47/57 (82%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D LCKEG V AA YF++R+ +EP+ V SVR++NILLNG FRSRKL+KAE+L+ +M+ Sbjct: 221 DTLCKEGLVRAASEYFEKRRLTEPSWVPSVRIFNILLNGWFRSRKLKKAEKLWSEMK 277 >ref|XP_009788683.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Nicotiana sylvestris] Length = 602 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGHV A YF +RK + N S+R YNILLNG FRSRK++KAERL+ +M+ Sbjct: 227 DSLCKEGHVKVASEYFYRRKGQDSNWSSSIRAYNILLNGWFRSRKIKKAERLWAEMK 283 >ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Solanum lycopersicum] Length = 602 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGH+ A YF +RK + N S+RVYNILLNG FRSRKL+KAERL+ +M+ Sbjct: 229 DSLCKEGHIREASDYFYRRKGKDLNWSPSIRVYNILLNGWFRSRKLKKAERLWTEMK 285 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/57 (57%), Positives = 45/57 (78%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGHV A YF Q++ +P+ V S+RVYN+LLNG FRSRKL++AE+L+ M+ Sbjct: 222 DSLCKEGHVRVASEYFDQQRGLDPSWVPSIRVYNVLLNGWFRSRKLKRAEQLWRTMK 278 >ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] gi|222854612|gb|EEE92159.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] Length = 607 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGHV A YF ++ +P V SVR+YNILLNG FRSRKL+ AERL+ +M+ Sbjct: 232 DSLCKEGHVRVATDYFDRKVEKDPCWVPSVRIYNILLNGWFRSRKLKHAERLWLEMK 288 >ref|XP_011019735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Populus euphratica] Length = 607 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEGHV A +YF ++ +P V SVR+YNI+LNG FRSRKL+ AERL+ +M+ Sbjct: 232 DSLCKEGHVRVATNYFDRKVEKDPCWVPSVRIYNIMLNGWFRSRKLKHAERLWLEMK 288 >ref|XP_010453175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Camelina sativa] Length = 600 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRK-YSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 DALCKEGHV A Y ++R+ + N V SVR++NILLNG FRSRKL++AE+L+EDM+ Sbjct: 218 DALCKEGHVRDASMYLERRRGMMDSNWVPSVRIFNILLNGWFRSRKLKQAEKLWEDMK 275 >ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum tuberosum] Length = 604 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEG + A YF +RK + N S+RVYNILLNG FRSRKL+KAERL+ +M+ Sbjct: 229 DSLCKEGLIREASDYFYRRKGQDSNWSPSIRVYNILLNGWFRSRKLKKAERLWTEMK 285 >ref|XP_006399632.1| hypothetical protein EUTSA_v10013015mg [Eutrema salsugineum] gi|557100722|gb|ESQ41085.1| hypothetical protein EUTSA_v10013015mg [Eutrema salsugineum] Length = 603 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 DALCKEGHV A Y ++R+ + N V SVR++NILLNG FRSRKL++AE L+ +M+ Sbjct: 222 DALCKEGHVREASMYLERRRRIDSNWVPSVRIFNILLNGWFRSRKLKQAENLWAEMK 278 >ref|XP_009601410.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Nicotiana tomentosiformis] Length = 608 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+L KEGHV A YF +RK + N S+R YNILLNG FRSRKL+KAERL+ +M+ Sbjct: 233 DSLSKEGHVRVASEYFYRRKGQDTNWSPSIRAYNILLNGWFRSRKLKKAERLWAEMK 289 >ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] gi|462418970|gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEG V A YF ++ P+ + SVRVYNILLNG FRSRKL++AERL+ +M+ Sbjct: 234 DSLCKEGLVRVASEYFDMKRKLHPDWIPSVRVYNILLNGWFRSRKLKRAERLWAEMK 290 >ref|XP_011459843.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Fragaria vesca subsp. vesca] Length = 591 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+LCKEG V A YF ++ S + + SVRVYNILLNG FRSRKL+KAERL+ +M+ Sbjct: 216 DSLCKEGLVRVATEYFDGKRKSHRDWIPSVRVYNILLNGWFRSRKLKKAERLWVEMK 272 >ref|XP_009351090.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452173|ref|XP_009351091.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452176|ref|XP_009351092.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] gi|694452180|ref|XP_009351093.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] Length = 608 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+L KEG V A YF +++ PN + SVRVYNILLNG FRSRKL++AERL+ +MR Sbjct: 233 DSLSKEGLVRVASEYFDRKRKLHPNWIPSVRVYNILLNGWFRSRKLKQAERLWVEMR 289 >ref|XP_009372943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Pyrus x bretschneideri] Length = 608 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 D+L KEG V A YF +++ PN + SVRVYNILLNG FRSRKL++AERL+ +MR Sbjct: 233 DSLSKEGLVRVASEYFDRKRKLHPNWIPSVRVYNILLNGWFRSRKLKQAERLWVEMR 289 >ref|XP_009121967.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Brassica rapa] Length = 596 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 DALCKEGHV A Y ++R+ + N + SVR++NILLNG FR+RKL++AE L+ +M+ Sbjct: 211 DALCKEGHVTEASMYMERRRRMDSNWIPSVRIFNILLNGWFRARKLKQAENLWGEMK 267 >emb|CDX69767.1| BnaA10g21160D [Brassica napus] Length = 596 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 DALCKEGHV A Y ++R+ + N + SVR++NILLNG FR+RKL++AE L+ +M+ Sbjct: 211 DALCKEGHVTEASMYMERRRRMDSNWIPSVRIFNILLNGWFRARKLKQAENLWGEMK 267 >emb|CDX97091.1| BnaC09g45340D [Brassica napus] Length = 586 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = -3 Query: 171 DALCKEGHVNAAFSYFQQRKYSEPNRVFSVRVYNILLNGLFRSRKLRKAERLYEDMR 1 DALCKEGHV A Y ++R+ + N + SVR++NILLNG FR+RKL++AE L+ +M+ Sbjct: 210 DALCKEGHVTEASMYMERRRRMDSNWIPSVRIFNILLNGWFRARKLKQAENLWGEMK 266