BLASTX nr result
ID: Cinnamomum25_contig00037052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00037052 (209 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010065830.1| PREDICTED: probably inactive leucine-rich re... 61 3e-07 gb|KCW88181.1| hypothetical protein EUGRSUZ_A00568 [Eucalyptus g... 61 3e-07 ref|XP_010065811.1| PREDICTED: leucine-rich repeat receptor prot... 59 2e-06 >ref|XP_010065830.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 [Eucalyptus grandis] Length = 709 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 209 LNNNRLQGTIPRLVFELAKLRHLFLSNNNFSGTIALDMFKNFKNFSY 69 L+NN+L+G IP VFEL L +L LS+NNFSG++ +DMF+ FKN +Y Sbjct: 333 LSNNKLEGPIPAYVFELRGLNYLSLSSNNFSGSLHIDMFQQFKNLTY 379 >gb|KCW88181.1| hypothetical protein EUGRSUZ_A00568 [Eucalyptus grandis] Length = 1005 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 209 LNNNRLQGTIPRLVFELAKLRHLFLSNNNFSGTIALDMFKNFKNFSY 69 L+NN+L+G IP VFEL L +L LS+NNFSG++ +DMF+ FKN +Y Sbjct: 449 LSNNKLEGPIPAYVFELRGLNYLSLSSNNFSGSLHIDMFQQFKNLTY 495 >ref|XP_010065811.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Eucalyptus grandis] gi|629123749|gb|KCW88174.1| hypothetical protein EUGRSUZ_A00564 [Eucalyptus grandis] Length = 1045 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = -1 Query: 209 LNNNRLQGTIPRLVFELAKLRHLFLSNNNFSGTIALDMFKNFKNFSY 69 L+NN+L+G IP FEL L+HL LS+NNFSG++ +D+F+ KN +Y Sbjct: 458 LSNNKLEGPIPAYAFELRGLKHLSLSSNNFSGSLHIDVFQRLKNLTY 504