BLASTX nr result
ID: Cinnamomum25_contig00036997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036997 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 emb|CAN64316.1| hypothetical protein VITISV_027915 [Vitis vinifera] 59 2e-06 ref|XP_011033877.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_002303536.1| pentatricopeptide repeat-containing family p... 58 3e-06 >ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Vitis vinifera] Length = 580 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 131 SWASAIRSASQQGRFKEAISLYVQMQRTHLAPTTYSVSAALKA 3 SWA AIR ++Q G+FKEA +LYVQMQR L PTT+++S+ALKA Sbjct: 72 SWACAIRFSTQHGQFKEAFALYVQMQRWGLCPTTFALSSALKA 114 >ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Vitis vinifera] gi|296083555|emb|CBI23551.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 131 SWASAIRSASQQGRFKEAISLYVQMQRTHLAPTTYSVSAALKA 3 SWA AIR ++Q G+FKEA +LYVQMQR L PTT+++S+ALKA Sbjct: 72 SWACAIRFSTQHGQFKEAFALYVQMQRWGLWPTTFALSSALKA 114 >emb|CAN64316.1| hypothetical protein VITISV_027915 [Vitis vinifera] Length = 841 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 131 SWASAIRSASQQGRFKEAISLYVQMQRTHLAPTTYSVSAALKA 3 SWA AIR ++Q G+FKEA +LYVQMQR L PTT+++S+ALKA Sbjct: 68 SWACAIRFSTQHGQFKEAFALYVQMQRWGLWPTTFALSSALKA 110 >ref|XP_011033877.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Populus euphratica] gi|743871534|ref|XP_011033878.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Populus euphratica] gi|743871538|ref|XP_011033879.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Populus euphratica] gi|743871542|ref|XP_011033880.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Populus euphratica] gi|743871546|ref|XP_011033881.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Populus euphratica] Length = 576 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 152 FEPSNVISWASAIRSASQQGRFKEAISLYVQMQRTHLAPTTYSVSAALKA 3 F + SW AIR SQQG+FKEA+ LYVQMQR L P+T++VS+AL+A Sbjct: 64 FPHPDSFSWGWAIRYFSQQGQFKEALYLYVQMQRQGLCPSTFAVSSALRA 113 >ref|XP_002303536.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222840968|gb|EEE78515.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 596 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 131 SWASAIRSASQQGRFKEAISLYVQMQRTHLAPTTYSVSAALKA 3 SW AIR SQQG+FKEA+ LYVQMQR L P+T++VS+AL+A Sbjct: 91 SWGWAIRYFSQQGQFKEALYLYVQMQRQGLCPSTFAVSSALRA 133