BLASTX nr result
ID: Cinnamomum25_contig00036945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036945 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935985.1| PREDICTED: putative F-box protein PP2-B12 [E... 57 4e-06 >ref|XP_010935985.1| PREDICTED: putative F-box protein PP2-B12 [Elaeis guineensis] Length = 292 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/33 (78%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -3 Query: 241 DEGEEGDIEMSLMEVKGGH-KSGLIVEGIEMRP 146 DEGE+G++EMSLME+KGGH KSGLI++GIEMRP Sbjct: 258 DEGEDGEVEMSLMELKGGHWKSGLIIQGIEMRP 290