BLASTX nr result
ID: Cinnamomum25_contig00036868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036868 (307 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010044992.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 72 2e-10 ref|XP_010044991.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 72 2e-10 ref|XP_010044990.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 72 2e-10 gb|KCW87134.1| hypothetical protein EUGRSUZ_B03662 [Eucalyptus g... 72 2e-10 ref|XP_010928837.1| PREDICTED: DNA topoisomerase 6 subunit B [El... 68 2e-09 ref|XP_003543555.1| PREDICTED: DNA topoisomerase 6 subunit B-lik... 65 1e-08 gb|ADE75679.1| unknown [Picea sitchensis] 64 3e-08 ref|XP_010257406.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 64 4e-08 ref|XP_010257405.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 64 4e-08 ref|XP_010257404.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 64 4e-08 ref|XP_008782884.1| PREDICTED: DNA topoisomerase 6 subunit B [Ph... 64 4e-08 ref|XP_011653575.1| PREDICTED: DNA topoisomerase 6 subunit B [Cu... 63 7e-08 ref|XP_008449756.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 63 7e-08 ref|XP_008449755.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 63 7e-08 ref|XP_002513444.1| Type II DNA topoisomerase VI subunit B, puta... 63 7e-08 ref|XP_012092788.1| PREDICTED: DNA topoisomerase 6 subunit B [Ja... 63 9e-08 ref|XP_012463096.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 60 4e-07 ref|XP_012463095.1| PREDICTED: DNA topoisomerase 6 subunit B iso... 60 4e-07 gb|KHG04255.1| DNA topoisomerase 6 subunit B -like protein [Goss... 60 4e-07 ref|XP_007014896.1| Topoisomerase 6 subunit B isoform 1 [Theobro... 60 4e-07 >ref|XP_010044992.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X3 [Eucalyptus grandis] Length = 726 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/58 (63%), Positives = 47/58 (81%), Gaps = 4/58 (6%) Frame = -3 Query: 164 PIEQ----SLPMDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 PIE+ S+PM++ GS+ESP Q P++GKS+TP+KA +S LKQKSPAEFFAENKNI Sbjct: 38 PIEEFVFGSVPMEARGSSESPPDQ--PKRGKSKTPRKAKDSVLKQKSPAEFFAENKNI 93 >ref|XP_010044991.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X2 [Eucalyptus grandis] Length = 728 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/58 (63%), Positives = 47/58 (81%), Gaps = 4/58 (6%) Frame = -3 Query: 164 PIEQ----SLPMDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 PIE+ S+PM++ GS+ESP Q P++GKS+TP+KA +S LKQKSPAEFFAENKNI Sbjct: 38 PIEEFVFGSVPMEARGSSESPPDQ--PKRGKSKTPRKAKDSVLKQKSPAEFFAENKNI 93 >ref|XP_010044990.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X1 [Eucalyptus grandis] Length = 769 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/58 (63%), Positives = 47/58 (81%), Gaps = 4/58 (6%) Frame = -3 Query: 164 PIEQ----SLPMDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 PIE+ S+PM++ GS+ESP Q P++GKS+TP+KA +S LKQKSPAEFFAENKNI Sbjct: 38 PIEEFVFGSVPMEARGSSESPPDQ--PKRGKSKTPRKAKDSVLKQKSPAEFFAENKNI 93 >gb|KCW87134.1| hypothetical protein EUGRSUZ_B03662 [Eucalyptus grandis] Length = 814 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/58 (63%), Positives = 47/58 (81%), Gaps = 4/58 (6%) Frame = -3 Query: 164 PIEQ----SLPMDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 PIE+ S+PM++ GS+ESP Q P++GKS+TP+KA +S LKQKSPAEFFAENKNI Sbjct: 130 PIEEFVFGSVPMEARGSSESPPDQ--PKRGKSKTPRKAKDSVLKQKSPAEFFAENKNI 185 >ref|XP_010928837.1| PREDICTED: DNA topoisomerase 6 subunit B [Elaeis guineensis] Length = 677 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/48 (70%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTP-KKAPESALKQKSPAEFFAENKNI 3 MD++GS+ESP + KK ++GKS+TP KKA ES L QKSPAEFFAENKNI Sbjct: 1 MDANGSSESPEEPKKAKRGKSKTPQKKAKESVLTQKSPAEFFAENKNI 48 >ref|XP_003543555.1| PREDICTED: DNA topoisomerase 6 subunit B-like isoform 1 [Glycine max] gi|734397355|gb|KHN30110.1| DNA topoisomerase 6 subunit B [Glycine soja] Length = 673 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 MD DGS+ESP++ KK KS+TP+K E+ LKQKSPAEFFAENKNI Sbjct: 1 MDGDGSSESPIETKK---AKSKTPRKPKETILKQKSPAEFFAENKNI 44 >gb|ADE75679.1| unknown [Picea sitchensis] Length = 676 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 MDS+ S+ SPV+ K+ +K KS+TP K ES L QKSPAEFFAENKNI Sbjct: 1 MDSEESDGSPVEPKQKKKAKSKTPAKGKESVLTQKSPAEFFAENKNI 47 >ref|XP_010257406.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X3 [Nelumbo nucifera] Length = 629 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M+ GS+ESP ++P+KGKSR KKA ES LKQKSPAEFFAENKNI Sbjct: 1 MEVGGSSESP---EEPKKGKSRATKKAKESVLKQKSPAEFFAENKNI 44 >ref|XP_010257405.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X2 [Nelumbo nucifera] Length = 674 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M+ GS+ESP ++P+KGKSR KKA ES LKQKSPAEFFAENKNI Sbjct: 1 MEVGGSSESP---EEPKKGKSRATKKAKESVLKQKSPAEFFAENKNI 44 >ref|XP_010257404.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X1 [Nelumbo nucifera] Length = 675 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M+ GS+ESP ++P+KGKSR KKA ES LKQKSPAEFFAENKNI Sbjct: 1 MEVGGSSESP---EEPKKGKSRATKKAKESVLKQKSPAEFFAENKNI 44 >ref|XP_008782884.1| PREDICTED: DNA topoisomerase 6 subunit B [Phoenix dactylifera] Length = 676 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M+++GS+ES KK ++GKS+TP+KA ES L QKSPAEFFAENKNI Sbjct: 1 MEANGSSESLEVPKKAKRGKSKTPQKAKESLLTQKSPAEFFAENKNI 47 >ref|XP_011653575.1| PREDICTED: DNA topoisomerase 6 subunit B [Cucumis sativus] Length = 673 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M++ G +ESP +P+KGKS+TP+K ES LKQKSPAEFFAENKNI Sbjct: 1 MEAGGGSESP---DEPKKGKSKTPRKPKESILKQKSPAEFFAENKNI 44 >ref|XP_008449756.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X2 [Cucumis melo] Length = 612 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M++ G +ESP +P+KGKS+TP+K ES LKQKSPAEFFAENKNI Sbjct: 1 MEAGGGSESP---DEPKKGKSKTPRKPKESILKQKSPAEFFAENKNI 44 >ref|XP_008449755.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X1 [Cucumis melo] Length = 673 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M++ G +ESP +P+KGKS+TP+K ES LKQKSPAEFFAENKNI Sbjct: 1 MEAGGGSESP---DEPKKGKSKTPRKPKESILKQKSPAEFFAENKNI 44 >ref|XP_002513444.1| Type II DNA topoisomerase VI subunit B, putative [Ricinus communis] gi|223547352|gb|EEF48847.1| Type II DNA topoisomerase VI subunit B, putative [Ricinus communis] Length = 656 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 143 MDSDGSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 M++ GS+ESP +P+K KS+TP+K ES LKQKSPAEFFAENKNI Sbjct: 1 METGGSSESP---NEPKKSKSKTPRKPKESTLKQKSPAEFFAENKNI 44 >ref|XP_012092788.1| PREDICTED: DNA topoisomerase 6 subunit B [Jatropha curcas] Length = 675 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 131 GSNESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 GS+ESP + P+KGKS+TP+K ES LKQKSPAEFFAENKNI Sbjct: 6 GSSESPTE---PKKGKSKTPRKPKESILKQKSPAEFFAENKNI 45 >ref|XP_012463096.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X2 [Gossypium raimondii] Length = 665 Score = 60.5 bits (145), Expect = 4e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 NESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 +ESP + KK GKS+TPKKA ES LKQKSPAEFFAENKNI Sbjct: 3 SESPTETKK---GKSKTPKKAKESILKQKSPAEFFAENKNI 40 >ref|XP_012463095.1| PREDICTED: DNA topoisomerase 6 subunit B isoform X1 [Gossypium raimondii] gi|763816628|gb|KJB83480.1| hypothetical protein B456_013G250000 [Gossypium raimondii] Length = 669 Score = 60.5 bits (145), Expect = 4e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 NESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 +ESP + KK GKS+TPKKA ES LKQKSPAEFFAENKNI Sbjct: 3 SESPTETKK---GKSKTPKKAKESILKQKSPAEFFAENKNI 40 >gb|KHG04255.1| DNA topoisomerase 6 subunit B -like protein [Gossypium arboreum] Length = 669 Score = 60.5 bits (145), Expect = 4e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 125 NESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 +ESP + KK GKS+TPKKA ES LKQKSPAEFFAENKNI Sbjct: 3 SESPTETKK---GKSKTPKKAKESILKQKSPAEFFAENKNI 40 >ref|XP_007014896.1| Topoisomerase 6 subunit B isoform 1 [Theobroma cacao] gi|508785259|gb|EOY32515.1| Topoisomerase 6 subunit B isoform 1 [Theobroma cacao] Length = 669 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 125 NESPVQQKKPQKGKSRTPKKAPESALKQKSPAEFFAENKNI 3 +ESP++ KK GKS+TP+KA ES LKQKSPAEFFAENKNI Sbjct: 3 SESPIETKK---GKSKTPRKAKESILKQKSPAEFFAENKNI 40