BLASTX nr result
ID: Cinnamomum25_contig00036730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036730 (226 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010914353.1| PREDICTED: receptor-like cytosolic serine/th... 62 1e-07 ref|XP_010914352.1| PREDICTED: receptor-like cytosolic serine/th... 62 1e-07 ref|XP_002512317.1| ATP binding protein, putative [Ricinus commu... 59 1e-06 ref|XP_012089455.1| PREDICTED: receptor-like cytosolic serine/th... 58 2e-06 ref|XP_009373952.1| PREDICTED: autophagy-related protein 18h-lik... 58 3e-06 ref|XP_008366942.1| PREDICTED: LOW QUALITY PROTEIN: receptor-lik... 58 3e-06 ref|XP_008388607.1| PREDICTED: receptor-like cytosolic serine/th... 58 3e-06 ref|XP_010649822.1| PREDICTED: receptor-like cytosolic serine/th... 57 5e-06 ref|XP_010649821.1| PREDICTED: receptor-like cytosolic serine/th... 57 5e-06 ref|XP_010649820.1| PREDICTED: receptor-like cytosolic serine/th... 57 5e-06 >ref|XP_010914353.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 isoform X2 [Elaeis guineensis] Length = 506 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = +1 Query: 4 KLVHIPTIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAMEF 126 K++H P I+RTYSEEL D +EYN+T+YLNDL +H++LA++F Sbjct: 466 KVIHKPLIRRTYSEELFDAEEYNATRYLNDLTQHKKLALDF 506 >ref|XP_010914352.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 isoform X1 [Elaeis guineensis] Length = 510 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = +1 Query: 4 KLVHIPTIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAMEF 126 K++H P I+RTYSEEL D +EYN+T+YLNDL +H++LA++F Sbjct: 470 KVIHKPLIRRTYSEELFDAEEYNATRYLNDLTQHKKLALDF 510 >ref|XP_002512317.1| ATP binding protein, putative [Ricinus communis] gi|223548278|gb|EEF49769.1| ATP binding protein, putative [Ricinus communis] Length = 436 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 22 TIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAM 120 T+QRTYSEELLD EYNSTKYLNDL RH++LA+ Sbjct: 402 TLQRTYSEELLDAQEYNSTKYLNDLKRHKELAL 434 >ref|XP_012089455.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 [Jatropha curcas] Length = 499 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 22 TIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAM 120 + QRTYSEELLD EYNSTKYLNDL RHR+LA+ Sbjct: 465 SFQRTYSEELLDAQEYNSTKYLNDLKRHRELAL 497 >ref|XP_009373952.1| PREDICTED: autophagy-related protein 18h-like [Pyrus x bretschneideri] Length = 1432 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 22 TIQRTYSEELLDLDEYNSTKYLNDLNRHRQLA 117 +IQRTYSEELLD EYNSTKYL DLNRH+Q+A Sbjct: 457 SIQRTYSEELLDAQEYNSTKYLGDLNRHKQVA 488 >ref|XP_008366942.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like cytosolic serine/threonine-protein kinase RBK2 [Malus domestica] Length = 543 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 22 TIQRTYSEELLDLDEYNSTKYLNDLNRHRQLA 117 +IQRTYSEELLD EYNSTKYL DLNRH+Q+A Sbjct: 509 SIQRTYSEELLDAQEYNSTKYLGDLNRHKQVA 540 >ref|XP_008388607.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 [Malus domestica] Length = 491 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 22 TIQRTYSEELLDLDEYNSTKYLNDLNRHRQLA 117 +IQRTYSEELLD EYNSTKYL DLNRH+Q+A Sbjct: 457 SIQRTYSEELLDAQEYNSTKYLGDLNRHKQVA 488 >ref|XP_010649822.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 isoform X3 [Vitis vinifera] Length = 276 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 19 PTIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAME 123 P +QRTYSEELLD +EYNSTK+LNDL+RH ++ +E Sbjct: 241 PILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLE 275 >ref|XP_010649821.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 isoform X2 [Vitis vinifera] Length = 485 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 19 PTIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAME 123 P +QRTYSEELLD +EYNSTK+LNDL+RH ++ +E Sbjct: 450 PILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLE 484 >ref|XP_010649820.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2 isoform X1 [Vitis vinifera] gi|297736942|emb|CBI26143.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 19 PTIQRTYSEELLDLDEYNSTKYLNDLNRHRQLAME 123 P +QRTYSEELLD +EYNSTK+LNDL+RH ++ +E Sbjct: 452 PILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLE 486