BLASTX nr result
ID: Cinnamomum25_contig00036708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036708 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010323730.1| PREDICTED: putative cell wall protein [Solan... 69 2e-09 emb|CDP14741.1| unnamed protein product [Coffea canephora] 61 3e-07 >ref|XP_010323730.1| PREDICTED: putative cell wall protein [Solanum lycopersicum] Length = 126 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 229 YDGTVLIPGLGRYMVPKKGTHVNPFTYNPITGTN 128 YDGTVLIPG+GR +VP KGTHVNPFTYNPITG+N Sbjct: 48 YDGTVLIPGIGRVVVPPKGTHVNPFTYNPITGSN 81 >emb|CDP14741.1| unnamed protein product [Coffea canephora] Length = 131 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 232 GYDGTVLIPGLGRYMVPKKGTHVNPFTYNPITGTN 128 G DG+VLIPG+GRYM P+ GTH +P YNPITGTN Sbjct: 49 GNDGSVLIPGMGRYMFPRPGTHFDPINYNPITGTN 83