BLASTX nr result
ID: Cinnamomum25_contig00036674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036674 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010089785.1| hypothetical protein L484_008035 [Morus nota... 48 1e-06 ref|XP_002511026.1| cyclin-dependent protein kinase, putative [R... 44 5e-06 ref|XP_010258734.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera] 47 9e-06 >ref|XP_010089785.1| hypothetical protein L484_008035 [Morus notabilis] gi|587848083|gb|EXB38377.1| hypothetical protein L484_008035 [Morus notabilis] Length = 210 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 367 FHLNVTPTTFHTYCCYLQREM 305 FHLNV+PTTF TYCCYLQREM Sbjct: 145 FHLNVSPTTFQTYCCYLQREM 165 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 6/43 (13%) Frame = -1 Query: 314 ERDALESPPPINPVIAL------KSLKLQCCFSEEESATRKQQ 204 +R+ L PP++ A KSL L CFS+EES+ +K+Q Sbjct: 162 QREMLLMQPPLDHAAADSSLSFGKSLNLHLCFSDEESSRQKRQ 204 >ref|XP_002511026.1| cyclin-dependent protein kinase, putative [Ricinus communis] gi|223550141|gb|EEF51628.1| cyclin-dependent protein kinase, putative [Ricinus communis] Length = 203 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 367 FHLNVTPTTFHTYCCYLQREM 305 F LNVTP TFHTYC YLQREM Sbjct: 144 FQLNVTPNTFHTYCSYLQREM 164 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 290 PPINPVIALKSLKLQCCFSEEESATRKQ 207 PP+N ++LK+ CCFSE+ES +KQ Sbjct: 176 PPLNMA---RALKIHCCFSEDESTHQKQ 200 >ref|XP_010258734.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera] Length = 189 Score = 46.6 bits (109), Expect(2) = 9e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 367 FHLNVTPTTFHTYCCYLQREM 305 FHLNVTP+TFHTYC Y+QREM Sbjct: 143 FHLNVTPSTFHTYCSYIQREM 163 Score = 29.3 bits (64), Expect(2) = 9e-06 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 257 LKLQCCFSEEESATRKQQLTV 195 LKL CCF+E++ ++QQL V Sbjct: 169 LKLHCCFNEDDPTHQQQQLAV 189