BLASTX nr result
ID: Cinnamomum25_contig00036465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036465 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509448.1| trypsin domain-containing protein, putative ... 73 9e-11 ref|XP_009758667.1| PREDICTED: glyoxysomal processing protease, ... 72 2e-10 ref|XP_009602312.1| PREDICTED: glyoxysomal processing protease, ... 72 2e-10 ref|XP_006347008.1| PREDICTED: glyoxysomal processing protease, ... 72 2e-10 ref|XP_004232906.1| PREDICTED: glyoxysomal processing protease, ... 72 2e-10 ref|XP_012091641.1| PREDICTED: glyoxysomal processing protease, ... 70 4e-10 ref|XP_012091640.1| PREDICTED: glyoxysomal processing protease, ... 70 4e-10 ref|XP_010929302.1| PREDICTED: glyoxysomal processing protease, ... 70 6e-10 ref|XP_010929294.1| PREDICTED: glyoxysomal processing protease, ... 70 6e-10 ref|XP_010929289.1| PREDICTED: glyoxysomal processing protease, ... 70 6e-10 ref|XP_010655443.1| PREDICTED: glyoxysomal processing protease, ... 69 1e-09 ref|XP_009388884.1| PREDICTED: glyoxysomal processing protease, ... 69 1e-09 emb|CBI30593.3| unnamed protein product [Vitis vinifera] 69 1e-09 ref|XP_007148143.1| hypothetical protein PHAVU_006G183800g [Phas... 69 1e-09 ref|XP_012451718.1| PREDICTED: glyoxysomal processing protease, ... 69 2e-09 ref|XP_012451717.1| PREDICTED: glyoxysomal processing protease, ... 69 2e-09 gb|KHG05571.1| Glyoxysomal processing protease, glyoxysomal -lik... 69 2e-09 ref|XP_002305124.1| protease-related family protein [Populus tri... 69 2e-09 ref|XP_010686423.1| PREDICTED: glyoxysomal processing protease, ... 68 2e-09 gb|KEH36556.1| glyoxysomal processing protease, glyoxysomal-like... 68 2e-09 >ref|XP_002509448.1| trypsin domain-containing protein, putative [Ricinus communis] gi|223549347|gb|EEF50835.1| trypsin domain-containing protein, putative [Ricinus communis] Length = 729 Score = 72.8 bits (177), Expect = 9e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV++HGPDPKGLKMR HAFHL+ GKTTLSASGM+ Sbjct: 10 ARNFAVMVRVHGPDPKGLKMRNHAFHLYASGKTTLSASGMI 50 >ref|XP_009758667.1| PREDICTED: glyoxysomal processing protease, glyoxysomal [Nicotiana sylvestris] Length = 754 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV+I GPDPKGLKMR+HAFHL+ GKTTLSASGML Sbjct: 10 ARNYAVMVRIQGPDPKGLKMRKHAFHLYNSGKTTLSASGML 50 >ref|XP_009602312.1| PREDICTED: glyoxysomal processing protease, glyoxysomal [Nicotiana tomentosiformis] Length = 755 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV+I GPDPKGLKMR+HAFHL+ GKTTLSASGML Sbjct: 10 ARNYAVMVRIQGPDPKGLKMRKHAFHLYNSGKTTLSASGML 50 >ref|XP_006347008.1| PREDICTED: glyoxysomal processing protease, glyoxysomal-like [Solanum tuberosum] Length = 755 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV+I GPDPKGLKMR+HAFHL+ GKTTLSASGML Sbjct: 10 ARNYAVMVRIQGPDPKGLKMRKHAFHLYNSGKTTLSASGML 50 >ref|XP_004232906.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X1 [Solanum lycopersicum] gi|111183165|gb|ABH07902.1| putative protease/hydrolase [Solanum lycopersicum] Length = 753 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV+I GPDPKGLKMR+HAFHL+ GKTTLSASGML Sbjct: 10 ARNYAVMVRIQGPDPKGLKMRKHAFHLYNSGKTTLSASGML 50 >ref|XP_012091641.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X2 [Jatropha curcas] Length = 672 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV++HGPDPKGLKMR+HAFH + G TTLSASGML Sbjct: 10 ARNFAVMVRVHGPDPKGLKMRKHAFHQYNSGNTTLSASGML 50 >ref|XP_012091640.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X1 [Jatropha curcas] gi|643703928|gb|KDP20992.1| hypothetical protein JCGZ_21463 [Jatropha curcas] Length = 754 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV++HGPDPKGLKMR+HAFH + G TTLSASGML Sbjct: 10 ARNFAVMVRVHGPDPKGLKMRKHAFHQYNSGNTTLSASGML 50 >ref|XP_010929302.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X3 [Elaeis guineensis] Length = 681 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SVMV+I GPDPK LK++RHAFHLH+ GKTTLSASG+L Sbjct: 10 ARNFSVMVRIQGPDPKRLKIQRHAFHLHQSGKTTLSASGLL 50 >ref|XP_010929294.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X2 [Elaeis guineensis] Length = 714 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SVMV+I GPDPK LK++RHAFHLH+ GKTTLSASG+L Sbjct: 10 ARNFSVMVRIQGPDPKRLKIQRHAFHLHQSGKTTLSASGLL 50 >ref|XP_010929289.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X1 [Elaeis guineensis] Length = 715 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SVMV+I GPDPK LK++RHAFHLH+ GKTTLSASG+L Sbjct: 10 ARNFSVMVRIQGPDPKRLKIQRHAFHLHQSGKTTLSASGLL 50 >ref|XP_010655443.1| PREDICTED: glyoxysomal processing protease, glyoxysomal [Vitis vinifera] Length = 759 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV++ GPDPKGLKMR+HAFH + GKTTLSASGML Sbjct: 10 ARNFAVMVRVQGPDPKGLKMRKHAFHHYHSGKTTLSASGML 50 >ref|XP_009388884.1| PREDICTED: glyoxysomal processing protease, glyoxysomal [Musa acuminata subsp. malaccensis] Length = 710 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SV+V+ GPDPKGLKMR HAFHLH+ G TTLSASG+L Sbjct: 11 ARNFSVLVRSQGPDPKGLKMRNHAFHLHQTGSTTLSASGIL 51 >emb|CBI30593.3| unnamed protein product [Vitis vinifera] Length = 682 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV++ GPDPKGLKMR+HAFH + GKTTLSASGML Sbjct: 10 ARNFAVMVRVQGPDPKGLKMRKHAFHHYHSGKTTLSASGML 50 >ref|XP_007148143.1| hypothetical protein PHAVU_006G183800g [Phaseolus vulgaris] gi|561021366|gb|ESW20137.1| hypothetical protein PHAVU_006G183800g [Phaseolus vulgaris] Length = 736 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV++ GPDPKGLKMRRHAFH + G+TTLSASGML Sbjct: 10 ARNFAVMVRVRGPDPKGLKMRRHAFHQYRSGETTLSASGML 50 >ref|XP_012451718.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X2 [Gossypium raimondii] Length = 635 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SV+V++ GPDPKGLKMR HAFH + GKTTLSASGML Sbjct: 10 ARNFSVLVRVQGPDPKGLKMRNHAFHQYHSGKTTLSASGML 50 >ref|XP_012451717.1| PREDICTED: glyoxysomal processing protease, glyoxysomal isoform X1 [Gossypium raimondii] gi|763799779|gb|KJB66734.1| hypothetical protein B456_010G155400 [Gossypium raimondii] Length = 738 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SV+V++ GPDPKGLKMR HAFH + GKTTLSASGML Sbjct: 10 ARNFSVLVRVQGPDPKGLKMRNHAFHQYHSGKTTLSASGML 50 >gb|KHG05571.1| Glyoxysomal processing protease, glyoxysomal -like protein [Gossypium arboreum] Length = 738 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SV+V++ GPDPKGLKMR HAFH + GKTTLSASGML Sbjct: 10 ARNFSVLVRVQGPDPKGLKMRNHAFHQYHSGKTTLSASGML 50 >ref|XP_002305124.1| protease-related family protein [Populus trichocarpa] gi|222848088|gb|EEE85635.1| protease-related family protein [Populus trichocarpa] Length = 752 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN +VMV+I GPDPKGLKMR+HAFH + GKTTLSASG+L Sbjct: 10 ARNFAVMVRIQGPDPKGLKMRKHAFHQYNSGKTTLSASGLL 50 >ref|XP_010686423.1| PREDICTED: glyoxysomal processing protease, glyoxysomal [Beta vulgaris subsp. vulgaris] gi|870852709|gb|KMT04624.1| hypothetical protein BVRB_8g182780 [Beta vulgaris subsp. vulgaris] Length = 760 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN S MVKI+GPDPKGLKMR HAFH + GKTTLSASG L Sbjct: 47 ARNFSAMVKINGPDPKGLKMRNHAFHQYHSGKTTLSASGFL 87 >gb|KEH36556.1| glyoxysomal processing protease, glyoxysomal-like protein [Medicago truncatula] Length = 561 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 ARNISVMVKIHGPDPKGLKMRRHAFHLHELGKTTLSASGML 1 ARN SVMVKI GPDPKG+KMR+HAFH + G+TTLSASG+L Sbjct: 10 ARNFSVMVKIRGPDPKGMKMRKHAFHHYRSGETTLSASGLL 50