BLASTX nr result
ID: Cinnamomum25_contig00036296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036296 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010276478.1| PREDICTED: pentatricopeptide repeat-containi... 90 5e-16 ref|XP_008232464.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_002520121.1| pentatricopeptide repeat-containing protein,... 71 3e-10 ref|XP_010911686.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_012091918.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_007014404.1| Pentatricopeptide repeat superfamily protein... 70 6e-10 ref|XP_009594665.1| PREDICTED: putative pentatricopeptide repeat... 69 9e-10 ref|XP_010054683.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 gb|KCW77174.1| hypothetical protein EUGRSUZ_D01519 [Eucalyptus g... 69 1e-09 ref|XP_003623891.1| Pentatricopeptide repeat-containing protein ... 69 1e-09 gb|KEH23349.1| PPR containing plant-like protein [Medicago trunc... 69 1e-09 ref|XP_008777767.1| PREDICTED: putative pentatricopeptide repeat... 69 2e-09 ref|XP_012448179.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_009777621.1| PREDICTED: putative pentatricopeptide repeat... 68 2e-09 ref|XP_010269167.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_012083657.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_008806485.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_010545396.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_010545394.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_009417426.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 >ref|XP_010276478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Nelumbo nucifera] Length = 806 Score = 90.1 bits (222), Expect = 5e-16 Identities = 48/100 (48%), Positives = 70/100 (70%), Gaps = 1/100 (1%) Frame = -2 Query: 297 SLSLQILPISKTAQTQQASNNDF-ISPKTLRKTIQIQNIHPPNLHAHVIKSGLYADLYTS 121 +L + LP+ +T S+N F +S K L+ + Q+ P LH+H++K+GL +D+YT+ Sbjct: 13 ALPFRGLPLPRTQIKSPKSDNCFKVSLKNLKSSAQL-----PTLHSHLLKTGLLSDIYTA 67 Query: 120 NTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 NT+I+RYS+ G I A QLF+EM + NLVSWTSLISGY+R Sbjct: 68 NTLIHRYSESGCISQAEQLFNEMPQRNLVSWTSLISGYTR 107 >ref|XP_008232464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 [Prunus mume] Length = 601 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 LH HV+K GL DLY S ++++ Y+K+G + SA +LFDEM+E + VSWT+LI GY+R Sbjct: 145 LHCHVVKVGLCLDLYVSTSVVDMYAKFGRMSSASKLFDEMTETSRVSWTALICGYAR 201 >ref|XP_002520121.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540613|gb|EEF42176.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 589 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/62 (48%), Positives = 47/62 (75%) Frame = -2 Query: 186 IHPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGY 7 +H +LHA +K+G+ +D+ SN +IN YSK G ++ A ++FDEMS+ NLVSW+++ISGY Sbjct: 20 LHGLSLHAAALKTGMLSDIIVSNHVINLYSKCGNVIFARRMFDEMSDRNLVSWSAIISGY 79 Query: 6 SR 1 + Sbjct: 80 DQ 81 >ref|XP_010911686.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Elaeis guineensis] Length = 506 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/70 (45%), Positives = 52/70 (74%) Frame = -2 Query: 210 RKTIQIQNIHPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVS 31 R+ I+ ++H +H+H+IK+GL D+ ++T+I+++ + I+ A QLFDEM + +LVS Sbjct: 84 RELIKTPSLHAEIVHSHLIKTGLITDISNADTLIHKHCESDLIIHAQQLFDEMPDRDLVS 143 Query: 30 WTSLISGYSR 1 WTSLISGY+R Sbjct: 144 WTSLISGYTR 153 >ref|XP_012091918.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Jatropha curcas] gi|802787410|ref|XP_012091919.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Jatropha curcas] gi|643704150|gb|KDP21214.1| hypothetical protein JCGZ_21685 [Jatropha curcas] Length = 587 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/61 (52%), Positives = 45/61 (73%) Frame = -2 Query: 183 HPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYS 4 H LHA +K+G+ +D+ SN ++N Y+K G+I A QLFDEMSE NLVSW+++ISGY Sbjct: 21 HGLYLHAAALKTGMLSDVVVSNHVLNMYAKCGKITYARQLFDEMSERNLVSWSAMISGYD 80 Query: 3 R 1 + Sbjct: 81 Q 81 >ref|XP_007014404.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508784767|gb|EOY32023.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 589 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/58 (53%), Positives = 45/58 (77%) Frame = -2 Query: 174 NLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 + HA V+K+G+ AD+ SN ++N Y+K G+I A Q+FDEMSE NLVSW+++ISGY + Sbjct: 24 SFHAAVVKAGMQADVIVSNHVLNMYAKCGKISFARQVFDEMSEKNLVSWSAMISGYEQ 81 >ref|XP_009594665.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana tomentosiformis] Length = 1060 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 LH +IK+G+ DLY NT+IN Y K G+++SAH +FD M + NLV+W LI+GYSR Sbjct: 89 LHLDIIKNGVDKDLYLCNTLINLYVKSGDLVSAHDMFDRMLDRNLVTWACLITGYSR 145 >ref|XP_010054683.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 [Eucalyptus grandis] Length = 596 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/57 (49%), Positives = 42/57 (73%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 + +HV+K G ++DLY S ++ Y+KWG + +A LFD+MS +LVSWT+LI GY+R Sbjct: 138 VQSHVVKMGFWSDLYVSTAFVDLYAKWGSVEAARMLFDDMSVRSLVSWTALIGGYAR 194 >gb|KCW77174.1| hypothetical protein EUGRSUZ_D01519 [Eucalyptus grandis] Length = 565 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/57 (49%), Positives = 42/57 (73%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 + +HV+K G ++DLY S ++ Y+KWG + +A LFD+MS +LVSWT+LI GY+R Sbjct: 107 VQSHVVKMGFWSDLYVSTAFVDLYAKWGSVEAARMLFDDMSVRSLVSWTALIGGYAR 163 >ref|XP_003623891.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1288 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/85 (41%), Positives = 52/85 (61%) Frame = -2 Query: 255 TQQASNNDFISPKTLRKTIQIQNIHPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILS 76 +Q N+ P L+ +I N+ +HA V+K G +DL+ SN +I+ Y+ + E+ Sbjct: 789 SQALFGNNLTYPFLLKACARISNVSCTTVHARVLKLGFDSDLFVSNALIHGYAGFCELGF 848 Query: 75 AHQLFDEMSEINLVSWTSLISGYSR 1 A ++FDEMSE +LVSW SLI GY R Sbjct: 849 ARKVFDEMSERDLVSWNSLICGYGR 873 >gb|KEH23349.1| PPR containing plant-like protein [Medicago truncatula] Length = 569 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/85 (41%), Positives = 52/85 (61%) Frame = -2 Query: 255 TQQASNNDFISPKTLRKTIQIQNIHPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILS 76 +Q N+ P L+ +I N+ +HA V+K G +DL+ SN +I+ Y+ + E+ Sbjct: 70 SQALFGNNLTYPFLLKACARISNVSCTTVHARVLKLGFDSDLFVSNALIHGYAGFCELGF 129 Query: 75 AHQLFDEMSEINLVSWTSLISGYSR 1 A ++FDEMSE +LVSW SLI GY R Sbjct: 130 ARKVFDEMSERDLVSWNSLICGYGR 154 >ref|XP_008777767.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Phoenix dactylifera] Length = 1073 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -2 Query: 174 NLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 +LH +IK G DL+ SN +IN Y+K G + SAHQ+FD+M E N VSWT LI+G+++ Sbjct: 100 SLHLELIKKGFVGDLFLSNNLINLYAKAGNLASAHQIFDDMREKNAVSWTCLIAGHTQ 157 >ref|XP_012448179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Gossypium raimondii] gi|763786734|gb|KJB53730.1| hypothetical protein B456_009G002700 [Gossypium raimondii] Length = 589 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/58 (51%), Positives = 45/58 (77%) Frame = -2 Query: 174 NLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 +LHA V+K+G+ A++ SN ++N Y+K G I A Q+FDEMSE NLVSW++++SGY + Sbjct: 24 SLHAAVLKTGIQANVIVSNHVLNMYAKCGSINFARQVFDEMSEKNLVSWSAMVSGYEQ 81 >ref|XP_009777621.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451446|ref|XP_009777628.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451450|ref|XP_009777638.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451454|ref|XP_009777645.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451458|ref|XP_009777652.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451463|ref|XP_009777661.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] Length = 1059 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 LH +IK+G+ DLY NT+IN Y K G+++SA +FDEM + NLVSW LI+GYS+ Sbjct: 89 LHLDIIKNGVNKDLYLCNTLINLYVKGGDLVSARDVFDEMLDRNLVSWACLITGYSQ 145 >ref|XP_010269167.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Nelumbo nucifera] Length = 589 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/57 (52%), Positives = 44/57 (77%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 LHA IKSG +D++ SN ++N Y+K ++++A +FDEMSE NLVSW++LISGY + Sbjct: 29 LHASFIKSGFQSDVFLSNHVLNMYAKCKDVVAARCVFDEMSERNLVSWSALISGYDQ 85 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 1/78 (1%) Frame = -2 Query: 237 NDFISPKTLRKTIQIQNI-HPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLF 61 +DF L + +I H +HAH++++ L D+ N ++N Y+K G I+ A +F Sbjct: 307 DDFTFASVLASCAGLASIRHGGQVHAHLMRTRLNQDVGVGNALVNMYAKCGSIVYAETVF 366 Query: 60 DEMSEINLVSWTSLISGY 7 ++M + NLVSW ++I+GY Sbjct: 367 NQMFDHNLVSWNTMIAGY 384 >ref|XP_012083657.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 [Jatropha curcas] gi|643717197|gb|KDP28823.1| hypothetical protein JCGZ_14594 [Jatropha curcas] Length = 607 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = -2 Query: 171 LHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 +H HV+K G DLY S ++ Y+K+GE+ A +LFDEM+E +LVSWT+LI GY R Sbjct: 147 MHNHVVKIGFREDLYVSTAFVDMYAKFGELNMARKLFDEMTERSLVSWTALICGYVR 203 >ref|XP_008806485.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial [Phoenix dactylifera] Length = 767 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = -2 Query: 198 QIQNIHPPNL-HAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTS 22 Q++++H L H H+ SG+ AD+ N I+N Y K G + A QLFD M E NLVSWTS Sbjct: 83 QLKSLHHGRLVHHHLSDSGVAADVILRNHILNMYGKCGSLEEARQLFDAMPERNLVSWTS 142 Query: 21 LISGYSR 1 +ISGYS+ Sbjct: 143 MISGYSQ 149 >ref|XP_010545396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like isoform X2 [Tarenaya hassleriana] Length = 579 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -2 Query: 174 NLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 +LHA V+K G AD+ SN I+N Y+K G A +LFDEMSE NLVSW+++ISGY + Sbjct: 24 SLHARVVKVGFEADVVISNHILNMYAKCGGTKLARKLFDEMSERNLVSWSAMISGYDQ 81 >ref|XP_010545394.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like isoform X1 [Tarenaya hassleriana] gi|729356956|ref|XP_010545395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like isoform X1 [Tarenaya hassleriana] Length = 612 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -2 Query: 174 NLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYSR 1 +LHA V+K G AD+ SN I+N Y+K G A +LFDEMSE NLVSW+++ISGY + Sbjct: 24 SLHARVVKVGFEADVVISNHILNMYAKCGGTKLARKLFDEMSERNLVSWSAMISGYDQ 81 >ref|XP_009417426.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] gi|695058239|ref|XP_009417427.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] gi|695058241|ref|XP_009417428.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 593 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/61 (50%), Positives = 44/61 (72%) Frame = -2 Query: 183 HPPNLHAHVIKSGLYADLYTSNTIINRYSKWGEILSAHQLFDEMSEINLVSWTSLISGYS 4 H LHA VIK+G+ +DL SN +IN Y+K + S+HQ+FD MS N+VSW+++ISGY Sbjct: 21 HGIALHASVIKTGMDSDLVLSNHLINLYAKCKDFESSHQIFDHMSNRNIVSWSAMISGYD 80 Query: 3 R 1 + Sbjct: 81 Q 81