BLASTX nr result
ID: Cinnamomum25_contig00036132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036132 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009630755.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_009630755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Nicotiana tomentosiformis] Length = 610 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/60 (53%), Positives = 38/60 (63%) Frame = -3 Query: 190 SSSDASANTLILDAQTKSRVSNLIAKQHWSDLKTLISETKNPNKFLQILFESQFDANIIL 11 +S+ S L+ D KSRVS LI+KQHWS LK LI NP FLQ LF+S FD+ IL Sbjct: 30 TSTSTSTPNLVSDPLFKSRVSELISKQHWSQLKDLIKPI-NPTSFLQQLFDSGFDSATIL 88