BLASTX nr result
ID: Cinnamomum25_contig00035138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00035138 (386 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010261385.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_008356925.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_009341118.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_009350326.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_009366564.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_008354009.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_008344990.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_008232977.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 emb|CDP08758.1| unnamed protein product [Coffea canephora] 80 7e-13 ref|XP_007220199.1| hypothetical protein PRUPE_ppa003068mg [Prun... 80 7e-13 ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 80 7e-13 ref|XP_012843784.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Erythra... 79 2e-12 ref|XP_011092997.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 gb|AGZ20103.1| pentatricopeptide repeat-containing protein [Came... 77 3e-12 ref|XP_009768960.1| PREDICTED: pentatricopeptide repeat-containi... 77 6e-12 ref|XP_011659175.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_009626803.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_010055077.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 gb|KCW71555.1| hypothetical protein EUGRSUZ_E00097 [Eucalyptus g... 75 2e-11 >ref|XP_010261385.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Nelumbo nucifera] Length = 799 Score = 84.0 bits (206), Expect = 4e-14 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVS 233 LDKA+ELMD+MNEQ CNPDYIT+E+LTEWLSA+G++ LR FV G+EVS S Sbjct: 723 LDKAFELMDRMNEQACNPDYITMEVLTEWLSAIGETARLRNFVHGYEVSSS 773 >ref|XP_008356925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 83.2 bits (204), Expect = 6e-14 Identities = 38/52 (73%), Positives = 47/52 (90%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L+KA++LMDQM EQ CNPDYIT+EILTEWLSAVG++ LRRFVQG+EV+ S+ Sbjct: 722 LEKAFKLMDQMIEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYEVAAST 773 >ref|XP_009341118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Pyrus x bretschneideri] Length = 776 Score = 82.0 bits (201), Expect = 1e-13 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L KA++LMDQM EQ CNPDYIT+EILTEWLSAVG++ LRRFVQG+E++ +S Sbjct: 723 LQKAFKLMDQMVEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYEIAAAS 774 >ref|XP_009350326.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Pyrus x bretschneideri] Length = 773 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/52 (69%), Positives = 47/52 (90%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 LDKA++LMDQM +Q CNPDY+T+EIL+EWLSAVG++ LRRFVQG+EV+ S+ Sbjct: 721 LDKAFKLMDQMIKQACNPDYVTMEILSEWLSAVGETEKLRRFVQGYEVAAST 772 >ref|XP_009366564.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Pyrus x bretschneideri] gi|694380932|ref|XP_009366567.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Pyrus x bretschneideri] Length = 773 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/52 (69%), Positives = 47/52 (90%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 LDKA++LMDQM +Q CNPDY+T+EIL+EWLSAVG++ LRRFVQG+EV+ S+ Sbjct: 721 LDKAFKLMDQMIKQACNPDYVTMEILSEWLSAVGETEKLRRFVQGYEVAAST 772 >ref|XP_008354009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L KA++LMDQM EQ CNPDYIT+EILTEWLSAVG++ LRRFVQG++++ S+ Sbjct: 722 LQKAFQLMDQMVEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYDIAAST 773 >ref|XP_008344990.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L KA++LMDQM EQ CNPDYIT+EILTEWLSAVG++ LRRFVQG++++ S+ Sbjct: 722 LQKAFQLMDQMVEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYDIAAST 773 >ref|XP_008232977.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Prunus mume] Length = 776 Score = 80.1 bits (196), Expect = 5e-13 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L+KA+E MDQM E CNPDYIT+EILTEWLS VG+ LRRFVQG+EV+ S+ Sbjct: 724 LEKAFEFMDQMTEHACNPDYITMEILTEWLSTVGEMEKLRRFVQGYEVAAST 775 >emb|CDP08758.1| unnamed protein product [Coffea canephora] Length = 777 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVS 233 L+KA++LMD+M E+ CNPDY+T+EIL EWLSAVG++ LRRFVQG+EVS S Sbjct: 725 LEKAFKLMDEMTEKACNPDYVTMEILLEWLSAVGQTEKLRRFVQGYEVSAS 775 >ref|XP_007220199.1| hypothetical protein PRUPE_ppa003068mg [Prunus persica] gi|462416661|gb|EMJ21398.1| hypothetical protein PRUPE_ppa003068mg [Prunus persica] Length = 607 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L+KA+E MDQM + CNPDYIT+EILTEWLSAVG++ LRRFVQG+EV+ S+ Sbjct: 555 LEKAFEFMDQMIKHACNPDYITMEILTEWLSAVGETEKLRRFVQGYEVAAST 606 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L KA+ELMD+M E CNPDYIT+EILTEWLSAVG++ L+ FVQG+EVS S+ Sbjct: 713 LSKAFELMDRMTEHACNPDYITMEILTEWLSAVGETAKLKSFVQGYEVSASA 764 >ref|XP_012843784.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Erythranthe guttatus] Length = 747 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/53 (66%), Positives = 44/53 (83%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSSM 227 L+KA E MDQM EQ CNPDY+T+EILTEWLS VG+ LR+FVQG++VS S++ Sbjct: 695 LEKALEFMDQMTEQACNPDYVTMEILTEWLSEVGEIEKLRKFVQGYQVSASTI 747 >gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Erythranthe guttata] Length = 680 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/53 (66%), Positives = 44/53 (83%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSSM 227 L+KA E MDQM EQ CNPDY+T+EILTEWLS VG+ LR+FVQG++VS S++ Sbjct: 628 LEKALEFMDQMTEQACNPDYVTMEILTEWLSEVGEIEKLRKFVQGYQVSASTI 680 >ref|XP_011092997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Sesamum indicum] Length = 742 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 382 DKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVS 233 +K E MDQM EQ CNPDY+T+EILTEWLSAVG++ LR+FVQG++VS S Sbjct: 691 EKVLEFMDQMTEQACNPDYVTMEILTEWLSAVGETEKLRKFVQGYQVSAS 740 >gb|AGZ20103.1| pentatricopeptide repeat-containing protein [Camellia sinensis] Length = 771 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 L+KA+ELMDQM E CNPDYIT+EIL +WL AVG++ LR FVQG+EVS S+ Sbjct: 719 LEKAFELMDQMTEHACNPDYITMEILIDWLPAVGETEKLRSFVQGYEVSAST 770 >ref|XP_009768960.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Nicotiana sylvestris] Length = 755 Score = 76.6 bits (187), Expect = 6e-12 Identities = 31/52 (59%), Positives = 45/52 (86%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 ++KA+E+MDQM E CNPDYIT+E+LT+WLSA+G++ LR F++G+EVS S+ Sbjct: 703 VEKAFEIMDQMTENACNPDYITMEVLTQWLSAIGETEKLRSFLEGYEVSTST 754 >ref|XP_011659175.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] gi|700189345|gb|KGN44578.1| hypothetical protein Csa_7G336570 [Cucumis sativus] Length = 614 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSSM 227 LDKA++LMD+M EQ CNPDYIT+EILTEWLSAVG+ T L++F QG VS S++ Sbjct: 562 LDKAFKLMDRMVEQACNPDYITMEILTEWLSAVGEITKLKKFTQGCMVSDSAV 614 >ref|XP_009626803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Nicotiana tomentosiformis] Length = 758 Score = 75.5 bits (184), Expect = 1e-11 Identities = 30/52 (57%), Positives = 45/52 (86%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVSVSS 230 ++KA+++MDQM E CNPDYIT+E+LT+WLSA+G++ LR F++G+EVS S+ Sbjct: 706 VEKAFQIMDQMTENACNPDYITMEVLTQWLSAIGETEKLRSFLEGYEVSTST 757 >ref|XP_010055077.1| PREDICTED: pentatricopeptide repeat-containing protein At5g28460-like [Eucalyptus grandis] Length = 765 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVS 239 L KA+E+MD+MNE C PDY+T+EILTEWLSAVG+ L+ FVQG+EVS Sbjct: 713 LKKAFEMMDRMNEHACKPDYVTMEILTEWLSAVGEVGKLKNFVQGYEVS 761 >gb|KCW71555.1| hypothetical protein EUGRSUZ_E00097 [Eucalyptus grandis] Length = 783 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 385 LDKAYELMDQMNEQGCNPDYITVEILTEWLSAVGKSTTLRRFVQGHEVS 239 L KA+E+MD+MNE C PDY+T+EILTEWLSAVG+ L+ FVQG+EVS Sbjct: 731 LKKAFEMMDRMNEHACKPDYVTMEILTEWLSAVGEVGKLKNFVQGYEVS 779