BLASTX nr result
ID: Cinnamomum25_contig00034787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00034787 (297 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010678646.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 60 8e-07 ref|XP_009408924.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 60 8e-07 ref|XP_006344986.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 60 8e-07 ref|XP_004236162.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 60 8e-07 ref|XP_010915171.1| PREDICTED: LOW QUALITY PROTEIN: polynucleoti... 59 1e-06 ref|XP_008808921.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 59 1e-06 ref|XP_009768776.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 59 1e-06 ref|XP_009631975.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 58 2e-06 emb|CDP14910.1| unnamed protein product [Coffea canephora] 58 3e-06 ref|XP_006476700.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 58 3e-06 ref|XP_006439711.1| hypothetical protein CICLE_v10020622mg [Citr... 58 3e-06 ref|XP_002267234.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 58 3e-06 ref|XP_011622893.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase... 57 4e-06 >ref|XP_010678646.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Beta vulgaris subsp. vulgaris] gi|870858998|gb|KMT10462.1| hypothetical protein BVRB_5g115880 [Beta vulgaris subsp. vulgaris] Length = 390 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLPKTRATESGHK 155 S L VD+LLQGFIEIPT LLQV GC+SPYMS V+P ++ + K Sbjct: 337 SILASVDLLLQGFIEIPTSLLQVQGCISPYMSANVVPTSQLVDRASK 383 >ref|XP_009408924.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Musa acuminata subsp. malaccensis] Length = 385 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 289 LGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLPK 182 L KVD+LLQGFIEIPT LLQV GC+SPYMST VL K Sbjct: 344 LQKVDLLLQGFIEIPTGLLQVRGCLSPYMSTNVLHK 379 >ref|XP_006344986.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Solanum tuberosum] Length = 374 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 S L KVD+LLQGF+EIPT LLQV GC+SPYMS VLP Sbjct: 336 SSLQKVDLLLQGFVEIPTCLLQVQGCISPYMSADVLP 372 >ref|XP_004236162.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Solanum lycopersicum] Length = 374 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 S L KVD+LLQGF+EIPT LLQV GC+SPYMS VLP Sbjct: 336 SSLQKVDLLLQGFVEIPTCLLQVQGCISPYMSADVLP 372 >ref|XP_010915171.1| PREDICTED: LOW QUALITY PROTEIN: polynucleotide 5'-hydroxyl-kinase NOL9-like [Elaeis guineensis] Length = 389 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLPK 182 S L KVD+LLQG+IEIPT LLQV GC+SPYMST VL K Sbjct: 346 SSLRKVDLLLQGYIEIPTGLLQVRGCVSPYMSTKVLHK 383 >ref|XP_008808921.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform X2 [Phoenix dactylifera] Length = 389 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLPK 182 S L KVD+LLQG+IEIPT LLQV GC+SPYMST VL K Sbjct: 346 SSLRKVDLLLQGYIEIPTGLLQVRGCISPYMSTKVLHK 383 >ref|XP_009768776.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Nicotiana sylvestris] Length = 377 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 S L KVD+LLQGFI+IPT LLQV GC+SPYMS VLP Sbjct: 339 SSLQKVDLLLQGFIQIPTCLLQVQGCISPYMSADVLP 375 >ref|XP_009631975.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 isoform X1 [Nicotiana tomentosiformis] Length = 377 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 S + KVD+LLQGFI+IPT LLQV GC+SPYMS VLP Sbjct: 339 SSMQKVDLLLQGFIQIPTCLLQVQGCISPYMSADVLP 375 >emb|CDP14910.1| unnamed protein product [Coffea canephora] Length = 453 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 289 LGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 L KVD+LLQGFI+IPT LLQV GC+SPYMS VLP Sbjct: 417 LEKVDLLLQGFIQIPTCLLQVQGCVSPYMSANVLP 451 >ref|XP_006476700.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like isoform X1 [Citrus sinensis] gi|641850969|gb|KDO69841.1| hypothetical protein CISIN_1g017023mg [Citrus sinensis] Length = 379 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 289 LGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 L KVD+ LQGFI+IPT LLQV GCMSPYMS VLP Sbjct: 343 LEKVDLFLQGFIQIPTCLLQVQGCMSPYMSANVLP 377 >ref|XP_006439711.1| hypothetical protein CICLE_v10020622mg [Citrus clementina] gi|557541973|gb|ESR52951.1| hypothetical protein CICLE_v10020622mg [Citrus clementina] Length = 379 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 289 LGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 L KVD+ LQGFI+IPT LLQV GCMSPYMS VLP Sbjct: 343 LEKVDLFLQGFIQIPTCLLQVQGCMSPYMSANVLP 377 >ref|XP_002267234.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Vitis vinifera] gi|297734062|emb|CBI15309.3| unnamed protein product [Vitis vinifera] Length = 378 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 295 SDLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLP 185 S L KVD+LL GF++IPT LLQV GC+SPYMST VLP Sbjct: 340 STLEKVDLLLLGFVQIPTCLLQVQGCVSPYMSTNVLP 376 >ref|XP_011622893.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Amborella trichopoda] Length = 391 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 292 DLGKVDILLQGFIEIPTRLLQVSGCMSPYMSTTVLPKT 179 DL KVD+ LQG IEIPT LLQV GC+SPYMST VL T Sbjct: 353 DLEKVDLFLQGLIEIPTCLLQVKGCVSPYMSTNVLTVT 390