BLASTX nr result
ID: Cinnamomum25_contig00033999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00033999 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094850.1| PREDICTED: cyclin-dependent protein kinase i... 59 1e-06 >ref|XP_011094850.1| PREDICTED: cyclin-dependent protein kinase inhibitor SMR3-like [Sesamum indicum] Length = 177 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/67 (41%), Positives = 41/67 (61%) Frame = -2 Query: 296 EKKREKMEESFQPKAYQEHGIHKREAQKSQVEEDNDGFGTPPSIKHRMPANRKSPPAPMK 117 +KK+E++EE + + + R ++K EED+DGF TP S HR+PA + PPAP K Sbjct: 57 QKKKEQLEEIKNDEETDKATVSSRGSEKQIAEEDDDGFKTPTSSDHRIPATTQCPPAPKK 116 Query: 116 PRRVSMK 96 PR + K Sbjct: 117 PRPQTSK 123