BLASTX nr result
ID: Cinnamomum25_contig00033744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00033744 (217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010110033.1| Omega-hydroxypalmitate O-feruloyl transferas... 59 2e-06 >ref|XP_010110033.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis] gi|587938302|gb|EXC25051.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis] Length = 455 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -1 Query: 109 MHQSPELPDCVYPTHPIYIYPKSPTPKHVLYLSNLD 2 M +SPELPDC YP P + P SPTPKH LYLSNLD Sbjct: 1 MLKSPELPDCFYPNQPTLVCPNSPTPKHSLYLSNLD 36