BLASTX nr result
ID: Cinnamomum25_contig00033726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00033726 (407 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB51869.1| hypothetical protein B456_008G235500 [Gossypium r... 56 8e-06 >gb|KJB51869.1| hypothetical protein B456_008G235500 [Gossypium raimondii] Length = 113 Score = 56.2 bits (134), Expect = 8e-06 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 4/99 (4%) Frame = -3 Query: 318 SHCPGPVFAALLWPFALKIPLS-GCISRACTRFSVSSVLIVFRLSQVLFQEQ--SIRHGH 148 SH P+ A+L+ F LKI + R ++ L F+LSQ+ + + +GH Sbjct: 17 SHSASPLIASLICSFLLKISSRLSVLRRVYIDVFHATRLFFFQLSQIALEADHPASSNGH 76 Query: 147 RWERALRILCERAYVTR-RRFSTAQSHETSLHSVSMLAL 34 RW+RALR++C+R +T RR A+S E S H+++ML+L Sbjct: 77 RWQRALRLVCQR--ITHVRRSPPAESDEASFHTLTMLSL 113