BLASTX nr result
ID: Cinnamomum25_contig00032972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00032972 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492098.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 >ref|XP_004492098.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620 [Cicer arietinum] Length = 858 Score = 60.5 bits (145), Expect = 4e-07 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = -3 Query: 194 ILSCSSLNHLNQIHAHLLKTPPNLFLWNSIIRSNSSHLP-HTALHLFVKMLEDPVLNPNK 18 I SC N L QIHAH L T P+L LWNS+IR+ S L H A++L+ ML+ L P+K Sbjct: 41 IRSCKHFNPLLQIHAHFLVTNPSLILWNSLIRAYSRFLKFHKAINLYHTMLQIG-LEPDK 99 Query: 17 HTFTF 3 +TFTF Sbjct: 100 YTFTF 104