BLASTX nr result
ID: Cinnamomum25_contig00032858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00032858 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012070237.1| PREDICTED: WEB family protein At5g16730, chl... 59 1e-06 ref|XP_010106280.1| hypothetical protein L484_019794 [Morus nota... 58 2e-06 >ref|XP_012070237.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Jatropha curcas] gi|643732439|gb|KDP39535.1| hypothetical protein JCGZ_02555 [Jatropha curcas] Length = 843 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/85 (38%), Positives = 56/85 (65%), Gaps = 1/85 (1%) Frame = -3 Query: 253 LRDSNVEMESNKANELLALSSSSIDPQMLKVQKSKNVESELVES-TSIEKLELELSNAKD 77 L DS EME+N++N+++ I+ +++++K VE+EL+E SIE+L +EL AK Sbjct: 243 LLDSKHEMEANESNKIVMQLKEEIETLKQELKRAKGVENELIEKEASIEQLNVELEAAKM 302 Query: 76 RESQAMGFLSESKIRIEVLKVELEK 2 ES A ++E K RIE L++++E+ Sbjct: 303 AESYARNLVAEWKCRIEELEMQVEE 327 >ref|XP_010106280.1| hypothetical protein L484_019794 [Morus notabilis] gi|587922297|gb|EXC09697.1| hypothetical protein L484_019794 [Morus notabilis] Length = 596 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/90 (37%), Positives = 56/90 (62%), Gaps = 8/90 (8%) Frame = -3 Query: 247 DSNVEMESN-------KANELLALSSSSIDPQMLKVQKSKNVESELVES-TSIEKLELEL 92 +S+V+ E N KANE L++ I+ L+++K+K +E +L E S+EKL+ EL Sbjct: 47 ESSVQTELNSMKVLLYKANEELSIKEKLIESLKLQLEKAKGLELKLAEKEASLEKLKAEL 106 Query: 91 SNAKDRESQAMGFLSESKIRIEVLKVELEK 2 + K E+Q M FL+E++ R+ L+ E+EK Sbjct: 107 AKVKSFEAQTMAFLTENERRVRELETEMEK 136