BLASTX nr result
ID: Cinnamomum25_contig00032118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00032118 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61769.1| hypothetical protein VITISV_026771 [Vitis vinifera] 58 2e-06 ref|XP_006592896.1| PREDICTED: probable disease resistance prote... 57 4e-06 >emb|CAN61769.1| hypothetical protein VITISV_026771 [Vitis vinifera] Length = 1052 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/62 (46%), Positives = 37/62 (59%) Frame = -3 Query: 188 LKENEDILDKKIEELSCREIDVRAYLENANLQSGKRPKREVELWLKNVQSIKDEVLYIKQ 9 L EN L +K+ L CRE D+ LENA K+ KREVE WLK VQ +KD I+Q Sbjct: 24 LNENLTTLGEKMRRLECREEDINTELENAQYNRRKKAKREVENWLKEVQHVKDSAQKIEQ 83 Query: 8 KL 3 ++ Sbjct: 84 EV 85 >ref|XP_006592896.1| PREDICTED: probable disease resistance protein At4g27220-like [Glycine max] Length = 992 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/63 (49%), Positives = 39/63 (61%) Frame = -3 Query: 191 SLKENEDILDKKIEELSCREIDVRAYLENANLQSGKRPKREVELWLKNVQSIKDEVLYIK 12 S +N +L+ K+EEL E D+ LE A LQ GK+ KREVE W +NVQ K EV I Sbjct: 28 SFNDNVQVLEMKLEELCSLEYDINKELEIAELQQGKKRKREVENWQRNVQRKKIEVYGIV 87 Query: 11 QKL 3 Q+L Sbjct: 88 QEL 90