BLASTX nr result
ID: Cinnamomum25_contig00030586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00030586 (336 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011657190.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_011657187.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 gb|KGN47232.1| hypothetical protein Csa_6G222480 [Cucumis sativus] 57 4e-06 >ref|XP_011657190.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X2 [Cucumis sativus] Length = 1283 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = +3 Query: 201 QKFTYSRASPSIRWPNLKLQQETPIPDPHHFHTSPPPIPTVQIQH 335 QKF YSRASPS+RWPNLKL + +P HF PPP P H Sbjct: 39 QKFRYSRASPSVRWPNLKLNESFQLPSQTHFTAPPPPPPPPSQTH 83 >ref|XP_011657187.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Cucumis sativus] gi|778714110|ref|XP_011657188.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Cucumis sativus] gi|778714114|ref|XP_011657189.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic isoform X1 [Cucumis sativus] Length = 1470 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = +3 Query: 201 QKFTYSRASPSIRWPNLKLQQETPIPDPHHFHTSPPPIPTVQIQH 335 QKF YSRASPS+RWPNLKL + +P HF PPP P H Sbjct: 39 QKFRYSRASPSVRWPNLKLNESFQLPSQTHFTAPPPPPPPPSQTH 83 >gb|KGN47232.1| hypothetical protein Csa_6G222480 [Cucumis sativus] Length = 1285 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = +3 Query: 201 QKFTYSRASPSIRWPNLKLQQETPIPDPHHFHTSPPPIPTVQIQH 335 QKF YSRASPS+RWPNLKL + +P HF PPP P H Sbjct: 39 QKFRYSRASPSVRWPNLKLNESFQLPSQTHFTAPPPPPPPPSQTH 83