BLASTX nr result
ID: Cinnamomum25_contig00030212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00030212 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010250298.1| PREDICTED: uncharacterized protein LOC104592... 78 2e-12 ref|XP_010654554.1| PREDICTED: uncharacterized protein LOC100249... 71 2e-10 ref|XP_011654553.1| PREDICTED: uncharacterized protein LOC101219... 68 3e-09 ref|XP_008466491.1| PREDICTED: uncharacterized protein LOC103503... 67 4e-09 ref|XP_011016968.1| PREDICTED: AP-5 complex subunit beta-1 [Popu... 63 9e-08 ref|XP_010935508.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 62 1e-07 ref|XP_002312240.1| hypothetical protein POPTR_0008s08480g [Popu... 62 1e-07 gb|KHN05436.1| hypothetical protein glysoja_020401 [Glycine soja] 62 2e-07 ref|XP_003540703.1| PREDICTED: AP-5 complex subunit beta-1-like ... 62 2e-07 ref|XP_008803596.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 61 3e-07 ref|XP_012089641.1| PREDICTED: AP-5 complex subunit beta-1 [Jatr... 59 1e-06 ref|XP_007157305.1| hypothetical protein PHAVU_002G058700g [Phas... 59 1e-06 ref|XP_010112221.1| hypothetical protein L484_013045 [Morus nota... 58 2e-06 ref|XP_006826837.2| PREDICTED: uncharacterized protein LOC184223... 58 3e-06 gb|ERM94074.1| hypothetical protein AMTR_s00010p00090870 [Ambore... 58 3e-06 ref|XP_003537783.1| PREDICTED: AP-5 complex subunit beta-1-like ... 58 3e-06 gb|KDO53042.1| hypothetical protein CISIN_1g035781mg [Citrus sin... 57 6e-06 ref|XP_006484638.1| PREDICTED: AP-5 complex subunit beta-1-like ... 56 8e-06 ref|XP_006484637.1| PREDICTED: AP-5 complex subunit beta-1-like ... 56 8e-06 ref|XP_006484636.1| PREDICTED: AP-5 complex subunit beta-1-like ... 56 8e-06 >ref|XP_010250298.1| PREDICTED: uncharacterized protein LOC104592558 [Nelumbo nucifera] Length = 1129 Score = 78.2 bits (191), Expect = 2e-12 Identities = 42/76 (55%), Positives = 55/76 (72%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S +LLLT+ IH+L++ S N+S+L+TSVPLVPFN+PHSL+A S +E+S Sbjct: 190 SYILLLTSVIHDLVI----SKTNVSILTTSVPLVPFNVPHSLLATGEAGSSSGLNKELSV 245 Query: 50 LNSKELRKVMAFLLER 3 N +ELRKVMAFLLER Sbjct: 246 SNIRELRKVMAFLLER 261 >ref|XP_010654554.1| PREDICTED: uncharacterized protein LOC100249600 [Vitis vinifera] gi|297738260|emb|CBI27461.3| unnamed protein product [Vitis vinifera] Length = 1125 Score = 71.2 bits (173), Expect = 2e-10 Identities = 39/75 (52%), Positives = 50/75 (66%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S +LL T IHN++ R N+S+L+TSVPLVPFN+P ++ G S RE+S Sbjct: 193 SYILLFTLVIHNIVTRKV----NVSILNTSVPLVPFNVPQFVVGG--------SSREVSG 240 Query: 50 LNSKELRKVMAFLLE 6 LN KELR+VMAFLLE Sbjct: 241 LNFKELRRVMAFLLE 255 >ref|XP_011654553.1| PREDICTED: uncharacterized protein LOC101219595 [Cucumis sativus] gi|700194598|gb|KGN49775.1| hypothetical protein Csa_5G118180 [Cucumis sativus] Length = 1134 Score = 67.8 bits (164), Expect = 3e-09 Identities = 40/76 (52%), Positives = 54/76 (71%), Gaps = 1/76 (1%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREIS- 54 S +LL T I N++ + S+ +S+LSTS+PLVPFN+P S++A DSSS RE+S Sbjct: 208 SYILLFTTVISNIVAQKSS----VSILSTSIPLVPFNVPQSVLAP-----DSSSIREVSA 258 Query: 53 NLNSKELRKVMAFLLE 6 LNSKELR+ +AFLLE Sbjct: 259 GLNSKELRRAIAFLLE 274 >ref|XP_008466491.1| PREDICTED: uncharacterized protein LOC103503880 [Cucumis melo] Length = 1133 Score = 67.4 bits (163), Expect = 4e-09 Identities = 40/76 (52%), Positives = 54/76 (71%), Gaps = 1/76 (1%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREIS- 54 S +LL T I N++ + S+ +S+LSTS+PLVPFN+P S++A DSSS RE+S Sbjct: 208 SYILLFTTVISNIVAQRSS----VSILSTSIPLVPFNVPQSVLAP-----DSSSIREVSA 258 Query: 53 NLNSKELRKVMAFLLE 6 LNSKELR+ +AFLLE Sbjct: 259 GLNSKELRRAIAFLLE 274 >ref|XP_011016968.1| PREDICTED: AP-5 complex subunit beta-1 [Populus euphratica] Length = 1126 Score = 62.8 bits (151), Expect = 9e-08 Identities = 35/80 (43%), Positives = 49/80 (61%) Frame = -1 Query: 245 SDVCSSDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSG 66 S C S LLL T + N++ + N+S+ +TSVPLVPFN+P +++G + L S Sbjct: 187 SHACQSYLLLFTTVVFNIV----NTKLNVSIFNTSVPLVPFNVPQWVLSGGDENLIGSK- 241 Query: 65 REISNLNSKELRKVMAFLLE 6 + LN KELR+ MAFLLE Sbjct: 242 EAVVGLNYKELRRAMAFLLE 261 >ref|XP_010935508.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105055407 [Elaeis guineensis] Length = 1122 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/76 (50%), Positives = 49/76 (64%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S LLLL A I N+ L S+ + S+LSTS PLVPF++P SL + RE S+ Sbjct: 200 SYLLLLAAVIRNIALHGLLSSPS-SILSTSTPLVPFSVPQSL------FSSPDPNREPSD 252 Query: 50 LNSKELRKVMAFLLER 3 LN +E+R+VMAFLLER Sbjct: 253 LNLREIRRVMAFLLER 268 >ref|XP_002312240.1| hypothetical protein POPTR_0008s08480g [Populus trichocarpa] gi|222852060|gb|EEE89607.1| hypothetical protein POPTR_0008s08480g [Populus trichocarpa] Length = 1126 Score = 62.0 bits (149), Expect = 1e-07 Identities = 35/80 (43%), Positives = 50/80 (62%) Frame = -1 Query: 245 SDVCSSDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSG 66 S C S LLL T+ + N++ + N+S+L+TSVPLVPFN+P +++G + S Sbjct: 187 SHACQSYLLLFTSVVFNIV----NTKLNVSILNTSVPLVPFNVPQWVLSGGDEN-GIGSK 241 Query: 65 REISNLNSKELRKVMAFLLE 6 + LN KELR+ MAFLLE Sbjct: 242 EVVVGLNYKELRRAMAFLLE 261 >gb|KHN05436.1| hypothetical protein glysoja_020401 [Glycine soja] Length = 1106 Score = 61.6 bits (148), Expect = 2e-07 Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = -1 Query: 224 LLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREIS-NL 48 LLL T+ IHN++ R N+S+L+TSVP+VPFN P+ + DS SG +I L Sbjct: 191 LLLFTSVIHNIVARKL----NVSILNTSVPMVPFNAPNCV-------TDSGSGSDIGLGL 239 Query: 47 NSKELRKVMAFLLE 6 N KELR+ +AFLLE Sbjct: 240 NVKELRRALAFLLE 253 >ref|XP_003540703.1| PREDICTED: AP-5 complex subunit beta-1-like [Glycine max] Length = 1106 Score = 61.6 bits (148), Expect = 2e-07 Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = -1 Query: 224 LLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREIS-NL 48 LLL T+ IHN++ R N+S+L+TSVP+VPFN P+ + DS SG +I L Sbjct: 191 LLLFTSVIHNIVARKL----NVSILNTSVPMVPFNAPNCV-------TDSGSGSDIGLGL 239 Query: 47 NSKELRKVMAFLLE 6 N KELR+ +AFLLE Sbjct: 240 NVKELRRALAFLLE 253 >ref|XP_008803596.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103717108 [Phoenix dactylifera] Length = 1125 Score = 61.2 bits (147), Expect = 3e-07 Identities = 38/76 (50%), Positives = 49/76 (64%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S LLLL A + N+ L S+ + S+LSTS PLVPF+ P SL + Y RE S+ Sbjct: 200 SYLLLLAAVVRNIALHGLLSSPS-SVLSTSTPLVPFSAPQSLFSPPDPY------REPSD 252 Query: 50 LNSKELRKVMAFLLER 3 LN +E+R+VMAFLLER Sbjct: 253 LNVREIRRVMAFLLER 268 >ref|XP_012089641.1| PREDICTED: AP-5 complex subunit beta-1 [Jatropha curcas] gi|643707411|gb|KDP22964.1| hypothetical protein JCGZ_01661 [Jatropha curcas] Length = 1122 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/77 (40%), Positives = 48/77 (62%) Frame = -1 Query: 236 CSSDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREI 57 C S +LL T ++N++ R N+S+L+TSVPLVPFN+P + + +EI Sbjct: 191 CQSYMLLFTMVVYNIVNRKL----NVSILNTSVPLVPFNLPQWMF----------NSKEI 236 Query: 56 SNLNSKELRKVMAFLLE 6 + +N KELR+ +AFLL+ Sbjct: 237 AGVNGKELRRALAFLLD 253 >ref|XP_007157305.1| hypothetical protein PHAVU_002G058700g [Phaseolus vulgaris] gi|561030720|gb|ESW29299.1| hypothetical protein PHAVU_002G058700g [Phaseolus vulgaris] Length = 1104 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/74 (47%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = -1 Query: 224 LLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREI-SNL 48 LLL T+ IHN++ R + +S+L+TSVP+VPFN P+ + + SG E+ S L Sbjct: 191 LLLFTSVIHNIVARKLS----VSILNTSVPMVPFNAPNCV---------TGSGSELGSGL 237 Query: 47 NSKELRKVMAFLLE 6 N KELR+ MAFLLE Sbjct: 238 NVKELRRAMAFLLE 251 >ref|XP_010112221.1| hypothetical protein L484_013045 [Morus notabilis] gi|587946598|gb|EXC32930.1| hypothetical protein L484_013045 [Morus notabilis] Length = 1122 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/77 (44%), Positives = 48/77 (62%) Frame = -1 Query: 236 CSSDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREI 57 C S +LL T+ IHN+++ N+S+L+ SVPLVPF++P L++ SS G Sbjct: 196 CQSYILLFTSVIHNIVVERV----NVSILNNSVPLVPFSVPQILLSNEGS--ASSPG--- 246 Query: 56 SNLNSKELRKVMAFLLE 6 LN KELR+ +AFLLE Sbjct: 247 --LNYKELRRALAFLLE 261 >ref|XP_006826837.2| PREDICTED: uncharacterized protein LOC18422341 [Amborella trichopoda] Length = 1155 Score = 57.8 bits (138), Expect = 3e-06 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 12/86 (13%) Frame = -1 Query: 224 LLLLTAAIHNLIL---RSSASAHNI--------SLLSTSVPLVPFNIPHSLIAGA-AQYL 81 +LLLT +H+++ +S S N SLLS + P+VPFN+P L+A + Sbjct: 176 ILLLTHLVHDIVCLMGNNSRSKPNSPSPLSLASSLLSITNPIVPFNVPSFLVASIPGEES 235 Query: 80 DSSSGREISNLNSKELRKVMAFLLER 3 +S RE+S+LN KELR+VMAFLLER Sbjct: 236 NSIPFRELSSLNIKELRRVMAFLLER 261 >gb|ERM94074.1| hypothetical protein AMTR_s00010p00090870 [Amborella trichopoda] Length = 1171 Score = 57.8 bits (138), Expect = 3e-06 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 12/86 (13%) Frame = -1 Query: 224 LLLLTAAIHNLIL---RSSASAHNI--------SLLSTSVPLVPFNIPHSLIAGA-AQYL 81 +LLLT +H+++ +S S N SLLS + P+VPFN+P L+A + Sbjct: 192 ILLLTHLVHDIVCLMGNNSRSKPNSPSPLSLASSLLSITNPIVPFNVPSFLVASIPGEES 251 Query: 80 DSSSGREISNLNSKELRKVMAFLLER 3 +S RE+S+LN KELR+VMAFLLER Sbjct: 252 NSIPFRELSSLNIKELRRVMAFLLER 277 >ref|XP_003537783.1| PREDICTED: AP-5 complex subunit beta-1-like [Glycine max] gi|734431598|gb|KHN45822.1| hypothetical protein glysoja_047476 [Glycine soja] Length = 1111 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 1/74 (1%) Frame = -1 Query: 224 LLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLI-AGAAQYLDSSSGREISNL 48 LLL T+ IH+++ R N+S+L+TSVP+VPFN P+ + +G+ D SG L Sbjct: 194 LLLFTSVIHSIVARKL----NVSILTTSVPMVPFNAPNCVTDSGSGSSSDLGSG-----L 244 Query: 47 NSKELRKVMAFLLE 6 N KELR+ +AFLLE Sbjct: 245 NVKELRRALAFLLE 258 >gb|KDO53042.1| hypothetical protein CISIN_1g035781mg [Citrus sinensis] Length = 1123 Score = 56.6 bits (135), Expect = 6e-06 Identities = 34/75 (45%), Positives = 45/75 (60%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S +LLLT I+N++ R N+S+L+TSVPLVPFN+P + G + Sbjct: 201 SYILLLTNVIYNIVDRKL----NVSVLNTSVPLVPFNVPQLAL-----------GSNLMG 245 Query: 50 LNSKELRKVMAFLLE 6 LN KELR+ MAFLLE Sbjct: 246 LNFKELRRAMAFLLE 260 >ref|XP_006484638.1| PREDICTED: AP-5 complex subunit beta-1-like isoform X4 [Citrus sinensis] Length = 765 Score = 56.2 bits (134), Expect = 8e-06 Identities = 34/75 (45%), Positives = 45/75 (60%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S +LLLT I+N++ R N+S+L+TSVPLVPFN+P + G + Sbjct: 201 SYILLLTNVIYNIVDRKL----NVSVLNTSVPLVPFNVPQLAL-----------GSNLVG 245 Query: 50 LNSKELRKVMAFLLE 6 LN KELR+ MAFLLE Sbjct: 246 LNFKELRRAMAFLLE 260 >ref|XP_006484637.1| PREDICTED: AP-5 complex subunit beta-1-like isoform X3 [Citrus sinensis] Length = 1034 Score = 56.2 bits (134), Expect = 8e-06 Identities = 34/75 (45%), Positives = 45/75 (60%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S +LLLT I+N++ R N+S+L+TSVPLVPFN+P + G + Sbjct: 201 SYILLLTNVIYNIVDRKL----NVSVLNTSVPLVPFNVPQLAL-----------GSNLVG 245 Query: 50 LNSKELRKVMAFLLE 6 LN KELR+ MAFLLE Sbjct: 246 LNFKELRRAMAFLLE 260 >ref|XP_006484636.1| PREDICTED: AP-5 complex subunit beta-1-like isoform X2 [Citrus sinensis] Length = 1089 Score = 56.2 bits (134), Expect = 8e-06 Identities = 34/75 (45%), Positives = 45/75 (60%) Frame = -1 Query: 230 SDLLLLTAAIHNLILRSSASAHNISLLSTSVPLVPFNIPHSLIAGAAQYLDSSSGREISN 51 S +LLLT I+N++ R N+S+L+TSVPLVPFN+P + G + Sbjct: 201 SYILLLTNVIYNIVDRKL----NVSVLNTSVPLVPFNVPQLAL-----------GSNLVG 245 Query: 50 LNSKELRKVMAFLLE 6 LN KELR+ MAFLLE Sbjct: 246 LNFKELRRAMAFLLE 260