BLASTX nr result
ID: Cinnamomum25_contig00030000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00030000 (459 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098770.1| hypothetical protein L484_026151 [Morus nota... 98 2e-18 ref|XP_010270917.1| PREDICTED: craniofacial development protein ... 96 9e-18 ref|XP_012482243.1| PREDICTED: craniofacial development protein ... 96 1e-17 gb|KHG12800.1| tig [Gossypium arboreum] 96 1e-17 gb|KHG12799.1| Craniofacial development protein 1 [Gossypium arb... 96 1e-17 ref|XP_007035907.1| Craniofacial development protein 1 isoform 2... 96 1e-17 ref|XP_007035906.1| Craniofacial development protein 1 isoform 1... 96 1e-17 ref|XP_011011108.1| PREDICTED: craniofacial development protein ... 94 3e-17 ref|XP_011011100.1| PREDICTED: craniofacial development protein ... 94 3e-17 ref|XP_002314982.2| hypothetical protein POPTR_0010s16110g [Popu... 94 3e-17 gb|ABK95758.1| unknown [Populus trichocarpa] 94 3e-17 ref|XP_009386435.1| PREDICTED: craniofacial development protein ... 93 8e-17 ref|XP_012084145.1| PREDICTED: craniofacial development protein ... 93 8e-17 ref|XP_004138528.1| PREDICTED: craniofacial development protein ... 93 8e-17 ref|XP_004138527.1| PREDICTED: craniofacial development protein ... 93 8e-17 ref|XP_011072431.1| PREDICTED: craniofacial development protein ... 92 1e-16 ref|XP_008223436.1| PREDICTED: craniofacial development protein ... 92 2e-16 ref|XP_002519285.1| Craniofacial development protein, putative [... 92 2e-16 ref|XP_007222513.1| hypothetical protein PRUPE_ppa009838mg [Prun... 92 2e-16 gb|AAT08752.1| BCNT [Hyacinthus orientalis] 92 2e-16 >ref|XP_010098770.1| hypothetical protein L484_026151 [Morus notabilis] gi|587886902|gb|EXB75673.1| hypothetical protein L484_026151 [Morus notabilis] Length = 267 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 EDELDAYKKSSNQYLEKVSFLQRTD REFERERD RLALQAKRRPDMRED Sbjct: 217 EDELDAYKKSSNQYLEKVSFLQRTDYREFERERDVRLALQAKRRPDMRED 266 >ref|XP_010270917.1| PREDICTED: craniofacial development protein 1 [Nelumbo nucifera] gi|720047779|ref|XP_010270918.1| PREDICTED: craniofacial development protein 1 [Nelumbo nucifera] gi|720047784|ref|XP_010270919.1| PREDICTED: craniofacial development protein 1 [Nelumbo nucifera] gi|720047787|ref|XP_010270920.1| PREDICTED: craniofacial development protein 1 [Nelumbo nucifera] Length = 266 Score = 95.9 bits (237), Expect = 9e-18 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 E+ELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQ+KR+PDMRE+ Sbjct: 216 EEELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQSKRKPDMREE 265 >ref|XP_012482243.1| PREDICTED: craniofacial development protein 1 [Gossypium raimondii] gi|763761530|gb|KJB28784.1| hypothetical protein B456_005G069300 [Gossypium raimondii] Length = 289 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 EDELDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRP+MRED Sbjct: 239 EDELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPEMRED 288 >gb|KHG12800.1| tig [Gossypium arboreum] Length = 218 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 EDELDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRP+MRED Sbjct: 168 EDELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPEMRED 217 >gb|KHG12799.1| Craniofacial development protein 1 [Gossypium arboreum] Length = 289 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 EDELDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRP+MRED Sbjct: 239 EDELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPEMRED 288 >ref|XP_007035907.1| Craniofacial development protein 1 isoform 2, partial [Theobroma cacao] gi|508714936|gb|EOY06833.1| Craniofacial development protein 1 isoform 2, partial [Theobroma cacao] Length = 388 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 E+ELDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRPDMRED Sbjct: 338 EEELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPDMRED 387 >ref|XP_007035906.1| Craniofacial development protein 1 isoform 1 [Theobroma cacao] gi|508714935|gb|EOY06832.1| Craniofacial development protein 1 isoform 1 [Theobroma cacao] Length = 394 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 E+ELDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRPDMRED Sbjct: 344 EEELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPDMRED 393 >ref|XP_011011108.1| PREDICTED: craniofacial development protein 1 isoform X2 [Populus euphratica] Length = 319 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMREDL 306 EDELDAYKKSSNQYLE+VSFL+RTD REFERERDARLALQA+RR DMREDL Sbjct: 269 EDELDAYKKSSNQYLERVSFLERTDYREFERERDARLALQARRRTDMREDL 319 >ref|XP_011011100.1| PREDICTED: craniofacial development protein 1 isoform X1 [Populus euphratica] Length = 320 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMREDL 306 EDELDAYKKSSNQYLE+VSFL+RTD REFERERDARLALQA+RR DMREDL Sbjct: 270 EDELDAYKKSSNQYLERVSFLERTDYREFERERDARLALQARRRTDMREDL 320 >ref|XP_002314982.2| hypothetical protein POPTR_0010s16110g [Populus trichocarpa] gi|550329915|gb|EEF01153.2| hypothetical protein POPTR_0010s16110g [Populus trichocarpa] Length = 320 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMREDL 306 EDELDAYKKSSNQYLE+VSFL+RTD REFERERDARLALQA+RR DMREDL Sbjct: 270 EDELDAYKKSSNQYLERVSFLERTDYREFERERDARLALQARRRTDMREDL 320 >gb|ABK95758.1| unknown [Populus trichocarpa] Length = 287 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMREDL 306 EDELDAYKKSSNQYLE+VSFL+RTD REFERERDARLALQA+RR DMREDL Sbjct: 237 EDELDAYKKSSNQYLERVSFLERTDYREFERERDARLALQARRRTDMREDL 287 >ref|XP_009386435.1| PREDICTED: craniofacial development protein 1-like [Musa acuminata subsp. malaccensis] Length = 261 Score = 92.8 bits (229), Expect = 8e-17 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 E+ELD+YKKSSNQYL+KVSFLQRTD REFE ERDARLALQAKRRPDMRED Sbjct: 210 EEELDSYKKSSNQYLDKVSFLQRTDHREFEHERDARLALQAKRRPDMRED 259 >ref|XP_012084145.1| PREDICTED: craniofacial development protein 1 [Jatropha curcas] gi|643716202|gb|KDP27975.1| hypothetical protein JCGZ_19055 [Jatropha curcas] Length = 309 Score = 92.8 bits (229), Expect = 8e-17 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 EDELDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+R+ DMRED Sbjct: 258 EDELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRKTDMRED 307 >ref|XP_004138528.1| PREDICTED: craniofacial development protein 1 isoform X2 [Cucumis sativus] Length = 251 Score = 92.8 bits (229), Expect = 8e-17 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 E++LDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRPDMRE+ Sbjct: 201 EEDLDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPDMREE 250 >ref|XP_004138527.1| PREDICTED: craniofacial development protein 1 isoform X1 [Cucumis sativus] gi|700190405|gb|KGN45609.1| hypothetical protein Csa_6G00090 [Cucumis sativus] Length = 259 Score = 92.8 bits (229), Expect = 8e-17 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 E++LDAYKKSSNQYL+KVSFLQRTD REFERERDARLALQA+RRPDMRE+ Sbjct: 209 EEDLDAYKKSSNQYLDKVSFLQRTDYREFERERDARLALQARRRPDMREE 258 >ref|XP_011072431.1| PREDICTED: craniofacial development protein 1 [Sesamum indicum] Length = 275 Score = 92.0 bits (227), Expect = 1e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMREDL 306 EDELDAYKKSSNQYL+KVSFLQR D REFERERDARLALQAKRR +MR+DL Sbjct: 225 EDELDAYKKSSNQYLDKVSFLQRADYREFERERDARLALQAKRRTEMRDDL 275 >ref|XP_008223436.1| PREDICTED: craniofacial development protein 1 [Prunus mume] Length = 284 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 ++ELDAYKKSSNQYL+KV+FLQR D REFERERDARLALQ+KRRPDMRED Sbjct: 234 DEELDAYKKSSNQYLDKVNFLQRADFREFERERDARLALQSKRRPDMRED 283 >ref|XP_002519285.1| Craniofacial development protein, putative [Ricinus communis] gi|223541600|gb|EEF43149.1| Craniofacial development protein, putative [Ricinus communis] Length = 298 Score = 91.7 bits (226), Expect = 2e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 EDELDAYKKSSNQYL+KVSFLQRTD REFERERDARLA QA+RR DMRED Sbjct: 247 EDELDAYKKSSNQYLDKVSFLQRTDYREFERERDARLAQQARRRTDMRED 296 >ref|XP_007222513.1| hypothetical protein PRUPE_ppa009838mg [Prunus persica] gi|462419449|gb|EMJ23712.1| hypothetical protein PRUPE_ppa009838mg [Prunus persica] Length = 275 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 ++ELDAYKKSSNQYL+KV+FLQR D REFERERDARLALQ+KRRPDMRED Sbjct: 225 DEELDAYKKSSNQYLDKVNFLQRADFREFERERDARLALQSKRRPDMRED 274 >gb|AAT08752.1| BCNT [Hyacinthus orientalis] Length = 147 Score = 91.7 bits (226), Expect = 2e-16 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -2 Query: 458 EDELDAYKKSSNQYLEKVSFLQRTDLREFERERDARLALQAKRRPDMRED 309 ED+LDAYKKSSNQYL++VSFLQRTD+REFERERDARLA QAKRR DMRED Sbjct: 96 EDQLDAYKKSSNQYLDRVSFLQRTDMREFERERDARLASQAKRRTDMRED 145