BLASTX nr result
ID: Cinnamomum25_contig00029984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00029984 (410 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009357055.1| PREDICTED: cell division cycle protein 123 h... 79 1e-12 ref|XP_010244521.1| PREDICTED: cell division cycle protein 123 h... 79 2e-12 ref|XP_011458549.1| PREDICTED: cell division cycle protein 123 h... 78 3e-12 ref|XP_002310498.1| hypothetical protein POPTR_0007s03580g [Popu... 78 3e-12 ref|XP_006373038.1| hypothetical protein POPTR_0017s07590g [Popu... 78 3e-12 ref|XP_004290582.1| PREDICTED: cell division cycle protein 123 h... 78 3e-12 emb|CBI30976.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002274599.1| PREDICTED: cell division cycle protein 123 h... 77 3e-12 ref|XP_012069178.1| PREDICTED: cell division cycle protein 123 h... 77 5e-12 ref|XP_007041122.1| Temperature sensing protein-related [Theobro... 77 5e-12 ref|XP_011084997.1| PREDICTED: cell division cycle protein 123 h... 77 6e-12 ref|XP_010110242.1| hypothetical protein L484_009926 [Morus nota... 76 8e-12 ref|XP_011023022.1| PREDICTED: cell division cycle protein 123 h... 76 1e-11 ref|XP_002522614.1| Cell division cycle protein, putative [Ricin... 76 1e-11 ref|XP_007222315.1| hypothetical protein PRUPE_ppa008054mg [Prun... 76 1e-11 ref|XP_006448952.1| hypothetical protein CICLE_v10015850mg [Citr... 75 1e-11 ref|XP_006448951.1| hypothetical protein CICLE_v10015850mg [Citr... 75 1e-11 ref|XP_004499711.1| PREDICTED: cell division cycle protein 123 h... 75 1e-11 ref|XP_008379542.1| PREDICTED: LOW QUALITY PROTEIN: cell divisio... 75 2e-11 ref|XP_004488280.1| PREDICTED: cell division cycle protein 123 h... 75 2e-11 >ref|XP_009357055.1| PREDICTED: cell division cycle protein 123 homolog [Pyrus x bretschneideri] Length = 333 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 SLSIKT IHELPESF+ YLL+DS PFLLP SIS DDA P RI P +DDY+ Sbjct: 20 SLSIKTRIHELPESFVQYLLDDSGPFLLPVSISNDDAFPNRIHNPEEEDDYQ 71 >ref|XP_010244521.1| PREDICTED: cell division cycle protein 123 homolog [Nelumbo nucifera] Length = 336 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SI+T+IH LPE F+ YLLEDS PFLLP +ISG+DALPQRI P +DD+E Sbjct: 20 SVSIRTLIHRLPEDFVQYLLEDSGPFLLPQTISGEDALPQRIHNPEEEDDFE 71 >ref|XP_011458549.1| PREDICTED: cell division cycle protein 123 homolog isoform X2 [Fragaria vesca subsp. vesca] Length = 238 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SIKT IHELPESF+ YLL+DS PFLLP SIS +DALP RI P +DDY+ Sbjct: 20 SVSIKTRIHELPESFVQYLLDDSGPFLLPASISNEDALPNRIHNPEEEDDYQ 71 >ref|XP_002310498.1| hypothetical protein POPTR_0007s03580g [Populus trichocarpa] gi|222853401|gb|EEE90948.1| hypothetical protein POPTR_0007s03580g [Populus trichocarpa] Length = 336 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = -2 Query: 157 LSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 +SI+T+IHELPESF++YL++DS PFLLP SISG+DALP RI P ++DY+ Sbjct: 21 VSIRTVIHELPESFVEYLVDDSGPFLLPLSISGEDALPNRIHNPIDEEDYQ 71 >ref|XP_006373038.1| hypothetical protein POPTR_0017s07590g [Populus trichocarpa] gi|550319713|gb|ERP50835.1| hypothetical protein POPTR_0017s07590g [Populus trichocarpa] Length = 336 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = -2 Query: 154 SIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 SIKT+IHELPESF++YLL+DS PFLLP SISG+DALP RI P ++D++ Sbjct: 22 SIKTVIHELPESFVEYLLDDSGPFLLPHSISGEDALPNRIHNPVDEEDFQ 71 >ref|XP_004290582.1| PREDICTED: cell division cycle protein 123 homolog isoform X1 [Fragaria vesca subsp. vesca] Length = 336 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SIKT IHELPESF+ YLL+DS PFLLP SIS +DALP RI P +DDY+ Sbjct: 20 SVSIKTRIHELPESFVQYLLDDSGPFLLPASISNEDALPNRIHNPEEEDDYQ 71 >emb|CBI30976.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 77.4 bits (189), Expect = 3e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SIKT+IHELPESF+DYLL+D PFLLP SI+ +DALP RI P ++DY+ Sbjct: 20 SVSIKTLIHELPESFVDYLLDDHGPFLLPVSITNEDALPNRIHNPEEEEDYQ 71 >ref|XP_002274599.1| PREDICTED: cell division cycle protein 123 homolog [Vitis vinifera] gi|731405245|ref|XP_010655705.1| PREDICTED: cell division cycle protein 123 homolog [Vitis vinifera] Length = 338 Score = 77.4 bits (189), Expect = 3e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SIKT+IHELPESF+DYLL+D PFLLP SI+ +DALP RI P ++DY+ Sbjct: 20 SVSIKTLIHELPESFVDYLLDDHGPFLLPVSITNEDALPNRIHNPEEEEDYQ 71 >ref|XP_012069178.1| PREDICTED: cell division cycle protein 123 homolog [Jatropha curcas] gi|802577786|ref|XP_012069179.1| PREDICTED: cell division cycle protein 123 homolog [Jatropha curcas] gi|802577788|ref|XP_012069180.1| PREDICTED: cell division cycle protein 123 homolog [Jatropha curcas] gi|643734102|gb|KDP40945.1| hypothetical protein JCGZ_24944 [Jatropha curcas] Length = 331 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SIKTI HELPESF++YLL+DS PF+LP S+S +DALP RI P ++DY+ Sbjct: 20 SVSIKTITHELPESFVEYLLDDSGPFILPVSVSNEDALPNRIHNPIDEEDYQ 71 >ref|XP_007041122.1| Temperature sensing protein-related [Theobroma cacao] gi|508705057|gb|EOX96953.1| Temperature sensing protein-related [Theobroma cacao] Length = 334 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SI+T+IHELPESF+ YLL+DS PFLLP SIS +DALP RI P ++DY+ Sbjct: 20 SVSIRTLIHELPESFVQYLLDDSGPFLLPVSISNEDALPNRIHNPEEEEDYQ 71 >ref|XP_011084997.1| PREDICTED: cell division cycle protein 123 homolog [Sesamum indicum] gi|747075895|ref|XP_011084998.1| PREDICTED: cell division cycle protein 123 homolog [Sesamum indicum] Length = 336 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDY 8 S SIKTIIHELPESF+ YLL+DS PFLLP SI+ DDALP R+ KP +D+ Sbjct: 20 SCSIKTIIHELPESFVQYLLDDSGPFLLPLSITNDDALPNRVHKPEEQEDF 70 >ref|XP_010110242.1| hypothetical protein L484_009926 [Morus notabilis] gi|587938932|gb|EXC25621.1| hypothetical protein L484_009926 [Morus notabilis] Length = 324 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SIKT+IHELP+SF+DYLL+DS PFLLP S++ DDALP RI +DDY+ Sbjct: 7 SVSIKTLIHELPQSFVDYLLDDSGPFLLPISVTNDDALPNRIHNLDEEDDYQ 58 >ref|XP_011023022.1| PREDICTED: cell division cycle protein 123 homolog [Populus euphratica] gi|743827441|ref|XP_011023023.1| PREDICTED: cell division cycle protein 123 homolog [Populus euphratica] gi|743827445|ref|XP_011023024.1| PREDICTED: cell division cycle protein 123 homolog [Populus euphratica] gi|743936689|ref|XP_011012733.1| PREDICTED: cell division cycle protein 123 homolog [Populus euphratica] gi|743936692|ref|XP_011012734.1| PREDICTED: cell division cycle protein 123 homolog [Populus euphratica] gi|743936694|ref|XP_011012735.1| PREDICTED: cell division cycle protein 123 homolog [Populus euphratica] Length = 336 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/51 (64%), Positives = 43/51 (84%) Frame = -2 Query: 157 LSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 +SI+T+IHELPESF++YL +DS PFLLP SISG+DALP RI P ++DY+ Sbjct: 21 VSIRTVIHELPESFVEYLDDDSGPFLLPLSISGEDALPNRIHNPIDEEDYQ 71 >ref|XP_002522614.1| Cell division cycle protein, putative [Ricinus communis] gi|223538090|gb|EEF39701.1| Cell division cycle protein, putative [Ricinus communis] Length = 337 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/52 (61%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 SLSI+TI HELPESF++YLL+DS PF+LP S+S +DALP R+ P ++DY+ Sbjct: 20 SLSIRTITHELPESFVEYLLDDSGPFVLPMSVSNEDALPNRVHNPIDEEDYQ 71 >ref|XP_007222315.1| hypothetical protein PRUPE_ppa008054mg [Prunus persica] gi|462419251|gb|EMJ23514.1| hypothetical protein PRUPE_ppa008054mg [Prunus persica] Length = 347 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 SLSIKT IHELPESF+ YLL+DS PFLLP SIS +DA P RI P DDY+ Sbjct: 29 SLSIKTRIHELPESFVQYLLDDSGPFLLPVSISNEDAFPNRIHNPEEADDYQ 80 >ref|XP_006448952.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] gi|557551563|gb|ESR62192.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] Length = 338 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/52 (61%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SI+T+IHELPE F++YLL+DS PFLLP S+S DDALP RI + ++DY+ Sbjct: 23 SVSIRTLIHELPEYFVEYLLDDSGPFLLPASVSNDDALPNRIHNAFEEEDYQ 74 >ref|XP_006448951.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] gi|557551562|gb|ESR62191.1| hypothetical protein CICLE_v10015850mg [Citrus clementina] Length = 335 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/52 (61%), Positives = 43/52 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 S+SI+T+IHELPE F++YLL+DS PFLLP S+S DDALP RI + ++DY+ Sbjct: 20 SVSIRTLIHELPEYFVEYLLDDSGPFLLPASVSNDDALPNRIHNAFEEEDYQ 71 >ref|XP_004499711.1| PREDICTED: cell division cycle protein 123 homolog [Cicer arietinum] Length = 336 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDY 8 S+SIKTIIH+LPESFI YLL+DSKPF+LP SI +DALP RI P ++D+ Sbjct: 23 SVSIKTIIHQLPESFIQYLLDDSKPFVLPVSILNEDALPNRIHNPIDEEDF 73 >ref|XP_008379542.1| PREDICTED: LOW QUALITY PROTEIN: cell division cycle protein 123 homolog [Malus domestica] Length = 333 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 160 SLSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 SLSIKT IHELPESF+ YLL+DS PFLLP SIS DDA P RI +DDY+ Sbjct: 20 SLSIKTRIHELPESFVQYLLDDSGPFLLPVSISNDDAFPNRIHNLEEEDDYQ 71 >ref|XP_004488280.1| PREDICTED: cell division cycle protein 123 homolog [Cicer arietinum] Length = 336 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = -2 Query: 157 LSIKTIIHELPESFIDYLLEDSKPFLLPTSISGDDALPQRIQKPYPDDDYE 5 +SIKT+IH+LPESFIDYLL+DS PF+LPTS+ +DALP RI P ++D++ Sbjct: 21 VSIKTLIHQLPESFIDYLLDDSGPFVLPTSVLNEDALPNRIHNPVDEEDFQ 71