BLASTX nr result
ID: Cinnamomum25_contig00029897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00029897 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010658100.1| PREDICTED: disease resistance protein At4g27... 49 5e-07 ref|XP_006585198.1| PREDICTED: disease resistance protein At4g27... 47 5e-06 gb|KHN48063.1| Disease resistance protein [Glycine soja] 47 5e-06 >ref|XP_010658100.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Length = 1132 Score = 49.3 bits (116), Expect(2) = 5e-07 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = +1 Query: 91 APALKNIRGSSEWWEALEWENNDIKQRLQPLFFESR 198 A L++I G WWEALEW+ + IKQRLQPLF ++ Sbjct: 1095 ATKLRSIEGQQSWWEALEWKGDAIKQRLQPLFIPNQ 1130 Score = 30.8 bits (68), Expect(2) = 5e-07 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 2 WPSLEIIHIAGCPKLKSLSFTK 67 WPSL+ + I+ C KLKSL F K Sbjct: 1071 WPSLQEVEISKCFKLKSLPFNK 1092 >ref|XP_006585198.1| PREDICTED: disease resistance protein At4g27190-like isoform X1 [Glycine max] gi|571471077|ref|XP_006585199.1| PREDICTED: disease resistance protein At4g27190-like isoform X2 [Glycine max] Length = 991 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = +1 Query: 100 LKNIRGSSEWWEALEWENND-IKQRLQPLFFES 195 LK+I+G EWW+ LEW NND + QRLQP+F S Sbjct: 954 LKSIKGQQEWWDELEWTNNDEVYQRLQPIFAAS 986 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 2 WPSLEIIHIAGCPKLKSL 55 W SLE++ I CPKLK+L Sbjct: 927 WSSLELLRIHNCPKLKTL 944 >gb|KHN48063.1| Disease resistance protein [Glycine soja] Length = 945 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = +1 Query: 100 LKNIRGSSEWWEALEWENND-IKQRLQPLFFES 195 LK+I+G EWW+ LEW NND + QRLQP+F S Sbjct: 908 LKSIKGQQEWWDELEWTNNDEVYQRLQPIFAAS 940 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 2 WPSLEIIHIAGCPKLKSL 55 W SLE++ I CPKLK+L Sbjct: 881 WSSLELLRIHNCPKLKTL 898