BLASTX nr result
ID: Cinnamomum25_contig00029659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00029659 (308 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088127.1| hypothetical protein L484_013571 [Morus nota... 58 3e-06 >ref|XP_010088127.1| hypothetical protein L484_013571 [Morus notabilis] gi|587841332|gb|EXB31939.1| hypothetical protein L484_013571 [Morus notabilis] Length = 119 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/60 (48%), Positives = 35/60 (58%) Frame = -2 Query: 181 NLVSHLLSLSQRCTSMRELKTIHGRXXXXXXXXXXXXXXXXLRFAAVSPSGDVHYAHTLF 2 NLV+ L S+++ C SMR+LK IH RFAAVSPSGD+HYAH LF Sbjct: 10 NLVAALASMAESCLSMRDLKQIHAHAIVANLHRHHVVLGKIFRFAAVSPSGDLHYAHQLF 69