BLASTX nr result
ID: Cinnamomum25_contig00028711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00028711 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107039.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 86 1e-14 ref|XP_012575409.1| PREDICTED: uncharacterized protein LOC105852... 81 3e-13 ref|XP_002535140.1| conserved hypothetical protein [Ricinus comm... 55 4e-08 >ref|XP_010107039.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus notabilis] gi|587926104|gb|EXC13351.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus notabilis] Length = 275 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = +3 Query: 213 MVLVLRTVNGFASGLWARRNRMSSPGWSTVRQNRHRLGAIDGTW 344 MVLV RTVNGFASGLWA RNRMSSPGWSTV QNRHRLG IDGTW Sbjct: 1 MVLVRRTVNGFASGLWACRNRMSSPGWSTVCQNRHRLGTIDGTW 44 >ref|XP_012575409.1| PREDICTED: uncharacterized protein LOC105852994 [Cicer arietinum] Length = 385 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = +3 Query: 213 MVLVLRTVNGFASGLWARRNRMSSPGWSTVRQNRHRLGAIDGTW*AHLSPYGSAAGT 383 M LVL+TVNGFASGL R NRMSS GWSTVRQNRHRLGAIDGTW + + AGT Sbjct: 1 MALVLQTVNGFASGLGERWNRMSSLGWSTVRQNRHRLGAIDGTWLIPFNYVAALAGT 57 >ref|XP_002535140.1| conserved hypothetical protein [Ricinus communis] gi|223523945|gb|EEF27246.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 54.7 bits (130), Expect(2) = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 276 MSSPGWSTVRQNRHRLGAIDGTW 344 MSSPGWSTVRQNRHRLGAIDGTW Sbjct: 1 MSSPGWSTVRQNRHRLGAIDGTW 23 Score = 29.3 bits (64), Expect(2) = 4e-08 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 380 HIEMWVEEASKS 415 HIEMWVEEASKS Sbjct: 24 HIEMWVEEASKS 35