BLASTX nr result
ID: Cinnamomum25_contig00027951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00027951 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN32569.1| Pentatricopeptide repeat-containing protein, mito... 59 1e-06 ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_007159095.1| hypothetical protein PHAVU_002G208300g [Phas... 59 1e-06 ref|XP_010674212.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_008462724.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_010102179.1| hypothetical protein L484_024459 [Morus nota... 56 8e-06 >gb|KHN32569.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 401 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSISPT 1 RD YFA IHH+SNIVRRDFYLERTLNKL I+ T Sbjct: 35 RDEYFAVIHHVSNIVRRDFYLERTLNKLRITVT 67 >ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like isoform X1 [Glycine max] gi|571455122|ref|XP_006579993.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like isoform X2 [Glycine max] gi|571455124|ref|XP_006579994.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like isoform X3 [Glycine max] Length = 450 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSISPT 1 RD YFA IHH+SNIVRRDFYLERTLNKL I+ T Sbjct: 35 RDEYFAVIHHVSNIVRRDFYLERTLNKLRITVT 67 >ref|XP_007159095.1| hypothetical protein PHAVU_002G208300g [Phaseolus vulgaris] gi|561032510|gb|ESW31089.1| hypothetical protein PHAVU_002G208300g [Phaseolus vulgaris] Length = 448 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSISPT 1 RD YFA IHHISNIVRRDFYLERTLNKL I T Sbjct: 34 RDQYFAVIHHISNIVRRDFYLERTLNKLRIHVT 66 >ref|XP_010674212.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870862677|gb|KMT13865.1| hypothetical protein BVRB_4g077070 [Beta vulgaris subsp. vulgaris] Length = 472 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSISPT 1 +D YFAAIHHISNIVRRD YLERTLNKL I+ T Sbjct: 52 KDDYFAAIHHISNIVRRDIYLERTLNKLQITVT 84 >ref|XP_008462724.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Cucumis melo] Length = 455 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSIS 7 +D YFAAIHHIS+IVRRDFY+ERTLNKL IS Sbjct: 38 KDDYFAAIHHISHIVRRDFYMERTLNKLRIS 68 >ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Cucumis sativus] gi|700211711|gb|KGN66807.1| hypothetical protein Csa_1G695420 [Cucumis sativus] Length = 455 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSIS 7 +D YFAAIHHIS+IVRRDFY+ERTLNKL IS Sbjct: 38 KDDYFAAIHHISHIVRRDFYMERTLNKLRIS 68 >ref|XP_010102179.1| hypothetical protein L484_024459 [Morus notabilis] gi|587904926|gb|EXB93122.1| hypothetical protein L484_024459 [Morus notabilis] Length = 470 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 99 RDAYFAAIHHISNIVRRDFYLERTLNKLSIS 7 +D YFAAIHHISNIV+RDFY+ERTLNKL I+ Sbjct: 52 KDNYFAAIHHISNIVQRDFYMERTLNKLRIA 82