BLASTX nr result
ID: Cinnamomum25_contig00026875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00026875 (307 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79138.1| hypothetical protein VITISV_034815 [Vitis vinifera] 44 5e-06 >emb|CAN79138.1| hypothetical protein VITISV_034815 [Vitis vinifera] Length = 1596 Score = 44.3 bits (103), Expect(2) = 5e-06 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -2 Query: 306 WDLVCQPIANGGLGIRSIDKVNKALLGK*L*R--VGGSCLWRRI 181 W++VC NGGLGIR ID +NKALL K + R V LW+++ Sbjct: 1259 WEVVCTQKVNGGLGIRKIDLLNKALLSKWIWRFAVEEDILWKKV 1302 Score = 32.3 bits (72), Expect(2) = 5e-06 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 68 VRYKVHDGQRIKFWHGEWCGQ 6 +R+KV G R+ FW WCG+ Sbjct: 1342 IRFKVGKGTRVNFWTDHWCGE 1362