BLASTX nr result
ID: Cinnamomum25_contig00026577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00026577 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406425.1| PREDICTED: acetolactate synthase small subun... 68 2e-09 ref|XP_006664907.1| PREDICTED: acetolactate synthase small subun... 68 2e-09 ref|XP_011654464.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 ref|XP_010557052.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 ref|XP_010557051.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 gb|KGN49589.1| hypothetical protein Csa_5G013280 [Cucumis sativus] 67 4e-09 ref|XP_008450270.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 ref|XP_008450269.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 gb|KDO50434.1| hypothetical protein CISIN_1g047033mg, partial [C... 67 4e-09 gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japo... 67 4e-09 ref|XP_006470698.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citr... 67 4e-09 ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citr... 67 4e-09 ref|XP_007033634.1| ACT domain-containing small subunit of aceto... 67 4e-09 ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|50... 67 4e-09 ref|XP_004149627.1| PREDICTED: acetolactate synthase small subun... 67 4e-09 dbj|BAD19594.1| putative acetolactate synthase small subunit [Or... 67 4e-09 ref|NP_001047389.2| Os02g0608600, partial [Oryza sativa Japonica... 67 4e-09 ref|XP_009366239.1| PREDICTED: acetolactate synthase small subun... 67 5e-09 ref|XP_008354318.1| PREDICTED: acetolactate synthase small subun... 67 5e-09 >ref|XP_009406425.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 487 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S+P Sbjct: 454 EPYGICEVARTGRVALVRESGVDSKYLRGYSLP 486 >ref|XP_006664907.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Oryza brachyantha] Length = 412 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S+P Sbjct: 379 EPYGICEVARTGRVALVRESGVDSKYLRGYSLP 411 >ref|XP_011654464.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like isoform X2 [Cucumis sativus] Length = 437 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 404 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 436 >ref|XP_010557052.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like isoform X2 [Tarenaya hassleriana] Length = 417 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 384 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 416 >ref|XP_010557051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like isoform X1 [Tarenaya hassleriana] Length = 489 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 456 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 488 >gb|KGN49589.1| hypothetical protein Csa_5G013280 [Cucumis sativus] Length = 436 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 403 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 435 >ref|XP_008450270.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like isoform X2 [Cucumis melo] Length = 443 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 410 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 442 >ref|XP_008450269.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like isoform X1 [Cucumis melo] Length = 495 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 462 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 494 >gb|KDO50434.1| hypothetical protein CISIN_1g047033mg, partial [Citrus sinensis] Length = 514 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 481 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 513 >gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group] Length = 422 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 389 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 421 >ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Citrus sinensis] Length = 488 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 455 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 487 >ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548810|gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 488 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 455 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 487 >ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548809|gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 471 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 438 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 470 >ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] gi|508712663|gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] Length = 478 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 445 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 477 >ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|508712662|gb|EOY04559.1| Poly(A) polymerase 1 [Theobroma cacao] Length = 788 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 755 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 787 >ref|XP_004149627.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like isoform X1 [Cucumis sativus] Length = 489 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 456 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 488 >dbj|BAD19594.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] gi|47497949|dbj|BAD20154.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] Length = 323 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 290 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 322 >ref|NP_001047389.2| Os02g0608600, partial [Oryza sativa Japonica Group] gi|255671076|dbj|BAF09303.2| Os02g0608600, partial [Oryza sativa Japonica Group] Length = 340 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGRVALVRESGVDSKYLRG+S P Sbjct: 307 EPYGICEVARTGRVALVRESGVDSKYLRGYSFP 339 >ref|XP_009366239.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic [Pyrus x bretschneideri] Length = 489 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGR+ALVRESGVDSKYLRG+S P Sbjct: 456 EPYGICEVARTGRIALVRESGVDSKYLRGYSFP 488 >ref|XP_008354318.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Malus domestica] Length = 489 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 342 EPYGICEVARTGRVALVRESGVDSKYLRGFSIP 244 EPYGICEVARTGR+ALVRESGVDSKYLRG+S P Sbjct: 456 EPYGICEVARTGRIALVRESGVDSKYLRGYSFP 488