BLASTX nr result
ID: Cinnamomum25_contig00026151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00026151 (398 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008791978.1| PREDICTED: putative tRNA pseudouridine synth... 62 1e-07 ref|XP_008791977.1| PREDICTED: putative tRNA pseudouridine synth... 62 1e-07 ref|XP_008791976.1| PREDICTED: putative tRNA pseudouridine synth... 62 1e-07 ref|XP_008791973.1| PREDICTED: putative tRNA pseudouridine synth... 62 1e-07 ref|XP_010918180.1| PREDICTED: putative tRNA pseudouridine synth... 61 3e-07 ref|XP_010918179.1| PREDICTED: putative tRNA pseudouridine synth... 61 3e-07 ref|XP_006838680.1| PREDICTED: putative tRNA pseudouridine synth... 60 6e-07 emb|CDP07328.1| unnamed protein product [Coffea canephora] 60 7e-07 ref|XP_010063101.1| PREDICTED: putative tRNA pseudouridine synth... 60 7e-07 ref|XP_009390915.1| PREDICTED: putative tRNA pseudouridine synth... 58 2e-06 ref|XP_002510624.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_002448324.1| hypothetical protein SORBIDRAFT_06g025270 [S... 58 2e-06 ref|XP_012570847.1| PREDICTED: putative tRNA pseudouridine synth... 58 3e-06 gb|KHN12596.1| Putative tRNA pseudouridine synthase Pus10 [Glyci... 58 3e-06 ref|XP_010664094.1| PREDICTED: putative tRNA pseudouridine synth... 58 3e-06 gb|KEH40257.1| tRNA pseudouridine synthase Pus10, putative [Medi... 58 3e-06 emb|CBI18893.3| unnamed protein product [Vitis vinifera] 58 3e-06 ref|XP_002284814.1| PREDICTED: putative tRNA pseudouridine synth... 58 3e-06 ref|XP_007160608.1| hypothetical protein PHAVU_001G001600g [Phas... 58 3e-06 ref|XP_004499319.1| PREDICTED: putative tRNA pseudouridine synth... 58 3e-06 >ref|XP_008791978.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X6 [Phoenix dactylifera] Length = 388 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHPSIGS+LGC+AEILQLDVTDVKMD+F+ Sbjct: 358 GRTHPSIGSILGCRAEILQLDVTDVKMDFFD 388 >ref|XP_008791977.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X5 [Phoenix dactylifera] Length = 422 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHPSIGS+LGC+AEILQLDVTDVKMD+F+ Sbjct: 392 GRTHPSIGSILGCRAEILQLDVTDVKMDFFD 422 >ref|XP_008791976.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X4 [Phoenix dactylifera] Length = 437 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHPSIGS+LGC+AEILQLDVTDVKMD+F+ Sbjct: 407 GRTHPSIGSILGCRAEILQLDVTDVKMDFFD 437 >ref|XP_008791973.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X1 [Phoenix dactylifera] Length = 549 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHPSIGS+LGC+AEILQLDVTDVKMD+F+ Sbjct: 519 GRTHPSIGSILGCRAEILQLDVTDVKMDFFD 549 >ref|XP_010918180.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X2 [Elaeis guineensis] Length = 530 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHPSIG++LGC+AEILQLDVTDVKMD+F+ Sbjct: 500 GRTHPSIGAILGCRAEILQLDVTDVKMDFFD 530 >ref|XP_010918179.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X1 [Elaeis guineensis] Length = 554 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHPSIG++LGC+AEILQLDVTDVKMD+F+ Sbjct: 524 GRTHPSIGAILGCRAEILQLDVTDVKMDFFD 554 >ref|XP_006838680.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 [Amborella trichopoda] gi|548841186|gb|ERN01249.1| hypothetical protein AMTR_s00002p00244810 [Amborella trichopoda] Length = 526 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYFN 304 GRTHP++GS+LGC+AEILQLDVTDVKMD FN Sbjct: 495 GRTHPNLGSILGCRAEILQLDVTDVKMDCFN 525 >emb|CDP07328.1| unnamed protein product [Coffea canephora] Length = 572 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVTDVKMD F Sbjct: 543 GRTHPSIGSILGCRAEILQLDVTDVKMDCF 572 >ref|XP_010063101.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 [Eucalyptus grandis] gi|629104817|gb|KCW70286.1| hypothetical protein EUGRSUZ_F03532 [Eucalyptus grandis] Length = 563 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPS+GS+LGC+AEILQLDVTDVKMD F Sbjct: 534 GRTHPSVGSILGCRAEILQLDVTDVKMDVF 563 >ref|XP_009390915.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 [Musa acuminata subsp. malaccensis] Length = 546 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDV DVKMD F Sbjct: 516 GRTHPSIGSILGCRAEILQLDVVDVKMDLF 545 >ref|XP_002510624.1| conserved hypothetical protein [Ricinus communis] gi|223551325|gb|EEF52811.1| conserved hypothetical protein [Ricinus communis] Length = 565 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVT+VKMD F Sbjct: 533 GRTHPSIGSILGCRAEILQLDVTEVKMDCF 562 >ref|XP_002448324.1| hypothetical protein SORBIDRAFT_06g025270 [Sorghum bicolor] gi|241939507|gb|EES12652.1| hypothetical protein SORBIDRAFT_06g025270 [Sorghum bicolor] Length = 516 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDY 310 GRTHPSIG++LGC+AEILQLDVTDVKMD+ Sbjct: 486 GRTHPSIGAILGCRAEILQLDVTDVKMDF 514 >ref|XP_012570847.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X2 [Cicer arietinum] Length = 481 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVTD+KM+ F Sbjct: 450 GRTHPSIGSMLGCRAEILQLDVTDIKMECF 479 >gb|KHN12596.1| Putative tRNA pseudouridine synthase Pus10 [Glycine soja] Length = 488 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVTD+KM+ F Sbjct: 457 GRTHPSIGSILGCRAEILQLDVTDIKMECF 486 >ref|XP_010664094.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X2 [Vitis vinifera] Length = 446 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPS+GS+LGC+AEILQLDVT+VKMD F Sbjct: 414 GRTHPSVGSILGCRAEILQLDVTEVKMDCF 443 >gb|KEH40257.1| tRNA pseudouridine synthase Pus10, putative [Medicago truncatula] Length = 472 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVTD+KM+ F Sbjct: 441 GRTHPSIGSMLGCRAEILQLDVTDIKMECF 470 >emb|CBI18893.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPS+GS+LGC+AEILQLDVT+VKMD F Sbjct: 559 GRTHPSVGSILGCRAEILQLDVTEVKMDCF 588 >ref|XP_002284814.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X1 [Vitis vinifera] Length = 578 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPS+GS+LGC+AEILQLDVT+VKMD F Sbjct: 546 GRTHPSVGSILGCRAEILQLDVTEVKMDCF 575 >ref|XP_007160608.1| hypothetical protein PHAVU_001G001600g [Phaseolus vulgaris] gi|561034072|gb|ESW32602.1| hypothetical protein PHAVU_001G001600g [Phaseolus vulgaris] Length = 503 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVTD+KM+ F Sbjct: 472 GRTHPSIGSILGCRAEILQLDVTDIKMECF 501 >ref|XP_004499319.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X1 [Cicer arietinum] gi|502126472|ref|XP_004499320.1| PREDICTED: putative tRNA pseudouridine synthase Pus10 isoform X1 [Cicer arietinum] Length = 508 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 396 GRTHPSIGSLLGCKAEILQLDVTDVKMDYF 307 GRTHPSIGS+LGC+AEILQLDVTD+KM+ F Sbjct: 477 GRTHPSIGSMLGCRAEILQLDVTDIKMECF 506