BLASTX nr result
ID: Cinnamomum25_contig00026131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00026131 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011461951.1| PREDICTED: pentatricopeptide repeat-containi... 126 6e-27 ref|XP_010045870.1| PREDICTED: pentatricopeptide repeat-containi... 125 8e-27 gb|KDO58423.1| hypothetical protein CISIN_1g036237mg [Citrus sin... 124 2e-26 ref|XP_012081524.1| PREDICTED: pentatricopeptide repeat-containi... 124 3e-26 ref|XP_012485806.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_008342194.1| PREDICTED: pentatricopeptide repeat-containi... 122 7e-26 ref|XP_009365211.1| PREDICTED: pentatricopeptide repeat-containi... 122 9e-26 ref|XP_008462083.1| PREDICTED: pentatricopeptide repeat-containi... 122 9e-26 ref|XP_008379986.1| PREDICTED: pentatricopeptide repeat-containi... 122 9e-26 ref|XP_006447757.1| hypothetical protein CICLE_v10014482mg [Citr... 121 2e-25 ref|XP_007215365.1| hypothetical protein PRUPE_ppa005588mg [Prun... 119 1e-24 ref|XP_010112786.1| hypothetical protein L484_020017 [Morus nota... 118 1e-24 gb|KGN43423.1| hypothetical protein Csa_7G033310 [Cucumis sativus] 118 2e-24 ref|XP_004144616.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_007049307.1| Pentatricopeptide repeat superfamily protein... 117 2e-24 ref|XP_008779860.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_010657439.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 ref|XP_010557707.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 ref|XP_008229896.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 emb|CBI28420.3| unnamed protein product [Vitis vinifera] 116 7e-24 >ref|XP_011461951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like, partial [Fragaria vesca subsp. vesca] Length = 679 Score = 126 bits (316), Expect = 6e-27 Identities = 58/81 (71%), Positives = 66/81 (81%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLGMHGMADQ L +F EM+ + PH ITFIGILNACSH GLV+ GR YF MMR Sbjct: 376 TAIIVGLGMHGMADQVLQLFLEMRTNGMEPHGITFIGILNACSHAGLVDLGRYYFNMMRK 435 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ PT EHYGCLVD+LCRA Sbjct: 436 DYGIEPTIEHYGCLVDILCRA 456 >ref|XP_010045870.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Eucalyptus grandis] gi|629124266|gb|KCW88691.1| hypothetical protein EUGRSUZ_A01046 [Eucalyptus grandis] Length = 688 Score = 125 bits (315), Expect = 8e-27 Identities = 55/81 (67%), Positives = 68/81 (83%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLGMHGMA AL +F EM++ + P+AITF+G++NAC+H GLV+ GR YFEMM+ Sbjct: 385 TAIIVGLGMHGMASPALQLFAEMRKAGVKPNAITFVGVINACNHAGLVDHGRHYFEMMQK 444 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 EYG+ PT EHYGCLVDLLCRA Sbjct: 445 EYGIEPTMEHYGCLVDLLCRA 465 >gb|KDO58423.1| hypothetical protein CISIN_1g036237mg [Citrus sinensis] Length = 689 Score = 124 bits (312), Expect = 2e-26 Identities = 56/80 (70%), Positives = 69/80 (86%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +A+IVGLGMHGMA QAL++F++M R + P AITFIG+LNACSH GLVN+GRRYF MM + Sbjct: 386 TAMIVGLGMHGMATQALDLFNKMCRMGMKPTAITFIGVLNACSHAGLVNDGRRYFNMMIN 445 Query: 183 EYGMTPTAEHYGCLVDLLCR 242 +YG+ PT EHYGCLVD+LCR Sbjct: 446 DYGIEPTIEHYGCLVDILCR 465 >ref|XP_012081524.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Jatropha curcas] Length = 674 Score = 124 bits (310), Expect = 3e-26 Identities = 54/81 (66%), Positives = 70/81 (86%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AI+VGLGMHGMA+ A +F+EM+R + PHAI FIG+LNACSH GLV++GR+YF+MM + Sbjct: 371 TAILVGLGMHGMAEDAQELFNEMRRIGMKPHAIIFIGLLNACSHAGLVDDGRQYFKMMTN 430 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 EYG+ P+ EHYGCLVD+LCRA Sbjct: 431 EYGIEPSIEHYGCLVDILCRA 451 >ref|XP_012485806.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Gossypium raimondii] gi|763742755|gb|KJB10254.1| hypothetical protein B456_001G191900 [Gossypium raimondii] Length = 682 Score = 123 bits (308), Expect = 5e-26 Identities = 54/81 (66%), Positives = 68/81 (83%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGL +HGMAD AL +F EM+R + P+AITF+G+LNACSHVGL+N+G +YF MM + Sbjct: 379 TAIIVGLSIHGMADHALKLFLEMRRIGVKPNAITFVGVLNACSHVGLINDGHKYFNMMIN 438 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 EYG+ P EHYGCLVD+LCRA Sbjct: 439 EYGIKPAIEHYGCLVDILCRA 459 >ref|XP_008342194.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Malus domestica] Length = 686 Score = 122 bits (307), Expect = 7e-26 Identities = 55/81 (67%), Positives = 67/81 (82%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 ++IIVGLGMHGMADQ L +F EM++ I PHAITFIG+LNACSH GLV+ GR YF +M + Sbjct: 383 TSIIVGLGMHGMADQVLELFLEMRKNGIQPHAITFIGVLNACSHSGLVDLGRYYFNLMTN 442 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ PT EHYGC VD+LCRA Sbjct: 443 DYGIEPTFEHYGCFVDILCRA 463 >ref|XP_009365211.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Pyrus x bretschneideri] Length = 686 Score = 122 bits (306), Expect = 9e-26 Identities = 54/81 (66%), Positives = 67/81 (82%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 ++IIVGLGMHGMADQ L +F EM++ + PHAITFIG+LNACSH GLV+ GR YF +M + Sbjct: 383 TSIIVGLGMHGMADQVLELFLEMRKNGMQPHAITFIGVLNACSHAGLVDLGRFYFNLMTN 442 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ PT EHYGC VD+LCRA Sbjct: 443 DYGIEPTIEHYGCFVDILCRA 463 >ref|XP_008462083.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis melo] Length = 681 Score = 122 bits (306), Expect = 9e-26 Identities = 52/81 (64%), Positives = 65/81 (80%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 ++IIVGLGMHG+ +Q L +FDEM R + PHAITFIG+LNACSH G + RYF+MM S Sbjct: 378 TSIIVGLGMHGLVEQTLELFDEMCRTGLQPHAITFIGVLNACSHAGFAEDAHRYFKMMTS 437 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ PT EHYGCL+D+LCRA Sbjct: 438 DYGIKPTIEHYGCLIDVLCRA 458 >ref|XP_008379986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Malus domestica] Length = 686 Score = 122 bits (306), Expect = 9e-26 Identities = 54/81 (66%), Positives = 67/81 (82%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 ++IIVGLGMHGMADQ L +F EM++ + PHAITFIG+LNACSH GLV+ GR YF +M + Sbjct: 383 TSIIVGLGMHGMADQVLELFLEMRKNGMQPHAITFIGVLNACSHAGLVDLGRFYFNLMTN 442 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ PT EHYGC VD+LCRA Sbjct: 443 DYGIEPTIEHYGCFVDILCRA 463 >ref|XP_006447757.1| hypothetical protein CICLE_v10014482mg [Citrus clementina] gi|568830445|ref|XP_006469509.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] gi|557550368|gb|ESR60997.1| hypothetical protein CICLE_v10014482mg [Citrus clementina] Length = 689 Score = 121 bits (303), Expect = 2e-25 Identities = 55/80 (68%), Positives = 67/80 (83%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +A+IVGLGMHGMA QAL +F++M R + P AITFIG+LNACSH GLVN+G RYF MM + Sbjct: 386 TAMIVGLGMHGMATQALYLFNKMCRMGMKPIAITFIGVLNACSHAGLVNDGHRYFNMMIN 445 Query: 183 EYGMTPTAEHYGCLVDLLCR 242 +YG+ PT EHYGCLVD+LCR Sbjct: 446 DYGIEPTIEHYGCLVDILCR 465 >ref|XP_007215365.1| hypothetical protein PRUPE_ppa005588mg [Prunus persica] gi|462411515|gb|EMJ16564.1| hypothetical protein PRUPE_ppa005588mg [Prunus persica] Length = 453 Score = 119 bits (297), Expect = 1e-24 Identities = 53/81 (65%), Positives = 66/81 (81%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLGMHGMADQ L +F EM++ + PH+ITFIG+LNACSH GLV+ GR YF +M + Sbjct: 150 TAIIVGLGMHGMADQVLELFLEMRKNGMRPHSITFIGVLNACSHAGLVDLGRYYFNLMIN 209 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +Y + PT EHYGC VD+LCRA Sbjct: 210 DYEIEPTIEHYGCFVDILCRA 230 >ref|XP_010112786.1| hypothetical protein L484_020017 [Morus notabilis] gi|587948648|gb|EXC34901.1| hypothetical protein L484_020017 [Morus notabilis] Length = 686 Score = 118 bits (296), Expect = 1e-24 Identities = 53/80 (66%), Positives = 65/80 (81%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLGMHGMA++AL +F EM+R + PHAITF+G+LNACSH GLV R YF MM + Sbjct: 383 TAIIVGLGMHGMAERALEMFSEMRRTGLQPHAITFLGVLNACSHAGLVELVRHYFNMMTN 442 Query: 183 EYGMTPTAEHYGCLVDLLCR 242 +YG+ PT EHYGCLV +LCR Sbjct: 443 DYGIEPTIEHYGCLVFILCR 462 >gb|KGN43423.1| hypothetical protein Csa_7G033310 [Cucumis sativus] Length = 434 Score = 118 bits (295), Expect = 2e-24 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +++IVGLGMHG+ +Q L +FDEM R + PHAITFIG+LNACSH G + RYF+MM Sbjct: 131 TSVIVGLGMHGLVEQTLELFDEMCRTGLKPHAITFIGVLNACSHAGFAEDAHRYFKMMTY 190 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ P+ EHYGCL+D+LCRA Sbjct: 191 DYGIKPSIEHYGCLIDVLCRA 211 >ref|XP_004144616.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 681 Score = 118 bits (295), Expect = 2e-24 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +++IVGLGMHG+ +Q L +FDEM R + PHAITFIG+LNACSH G + RYF+MM Sbjct: 378 TSVIVGLGMHGLVEQTLELFDEMCRTGLKPHAITFIGVLNACSHAGFAEDAHRYFKMMTY 437 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +YG+ P+ EHYGCL+D+LCRA Sbjct: 438 DYGIKPSIEHYGCLIDVLCRA 458 >ref|XP_007049307.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508701568|gb|EOX93464.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 682 Score = 117 bits (294), Expect = 2e-24 Identities = 53/81 (65%), Positives = 65/81 (80%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGL +HGMA+ AL F EM R + P+AITF+G+LNACSH GL+N+GR YF M + Sbjct: 379 TAIIVGLSIHGMAEHALEFFLEMCRIGVKPNAITFVGVLNACSHAGLINDGRGYFNTMIN 438 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 EYG+ PT EHYGCLVD+LCRA Sbjct: 439 EYGIKPTIEHYGCLVDMLCRA 459 >ref|XP_008779860.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like, partial [Phoenix dactylifera] Length = 685 Score = 117 bits (293), Expect = 3e-24 Identities = 52/85 (61%), Positives = 70/85 (82%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +A+I+GLGMHGMA+ A+ +F EMQR I PH+I F+G+L+ACSH G+V+EGR+YF++M Sbjct: 389 TAMIMGLGMHGMANDAIQLFMEMQRVGIRPHSIAFVGVLSACSHAGMVDEGRQYFDLMSK 448 Query: 183 EYGMTPTAEHYGCLVDLLCRAEIGR 257 EYG+ PT EH+G LVDLLCR +GR Sbjct: 449 EYGIKPTVEHHGSLVDLLCR--VGR 471 >ref|XP_010657439.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like isoform X1 [Vitis vinifera] Length = 682 Score = 116 bits (290), Expect = 7e-24 Identities = 52/81 (64%), Positives = 68/81 (83%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLG+HGMA+ AL +F EM + + P+AI FIG+LNAC+H GLV++GR+YF+MM + Sbjct: 379 TAIIVGLGIHGMANHALALFLEMCKTGLKPNAIIFIGVLNACNHAGLVDDGRQYFDMMMN 438 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 EY + PT EHYGCLVD+LCRA Sbjct: 439 EYKIEPTLEHYGCLVDILCRA 459 >ref|XP_010557707.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X1 [Tarenaya hassleriana] Length = 683 Score = 116 bits (290), Expect = 7e-24 Identities = 50/80 (62%), Positives = 66/80 (82%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 ++II GLGMHGMA++AL +F++M+ + P+AITF+G+LNACSH G VNE R YF +MR+ Sbjct: 380 NSIIAGLGMHGMANKALELFNKMRERGTEPNAITFVGVLNACSHTGYVNEARSYFYLMRN 439 Query: 183 EYGMTPTAEHYGCLVDLLCR 242 EYG+ T EHYGCLVD+LCR Sbjct: 440 EYGIEHTVEHYGCLVDVLCR 459 >ref|XP_008229896.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Prunus mume] Length = 684 Score = 116 bits (290), Expect = 7e-24 Identities = 51/81 (62%), Positives = 66/81 (81%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLGMHGMADQ L +F EM++ ++P+ ITF+G+LNACSH GLV+ GR YF +M + Sbjct: 381 TAIIVGLGMHGMADQVLEVFLEMRKNGMHPNGITFVGVLNACSHAGLVDLGRYYFNLMIN 440 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 +Y + PT EHYGC VD+LCRA Sbjct: 441 DYEIEPTIEHYGCFVDILCRA 461 >emb|CBI28420.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 116 bits (290), Expect = 7e-24 Identities = 52/81 (64%), Positives = 68/81 (83%) Frame = +3 Query: 3 SAIIVGLGMHGMADQALNIFDEMQRKRINPHAITFIGILNACSHVGLVNEGRRYFEMMRS 182 +AIIVGLG+HGMA+ AL +F EM + + P+AI FIG+LNAC+H GLV++GR+YF+MM + Sbjct: 328 TAIIVGLGIHGMANHALALFLEMCKTGLKPNAIIFIGVLNACNHAGLVDDGRQYFDMMMN 387 Query: 183 EYGMTPTAEHYGCLVDLLCRA 245 EY + PT EHYGCLVD+LCRA Sbjct: 388 EYKIEPTLEHYGCLVDILCRA 408