BLASTX nr result
ID: Cinnamomum25_contig00025900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00025900 (466 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putati... 69 9e-10 emb|CDP00812.1| unnamed protein product [Coffea canephora] 68 2e-09 ref|XP_004297467.1| PREDICTED: putative receptor-like protein ki... 68 3e-09 ref|XP_008221435.1| PREDICTED: putative cysteine-rich receptor-l... 67 4e-09 ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prun... 67 4e-09 ref|XP_009105741.1| PREDICTED: cysteine-rich receptor-like prote... 66 1e-08 emb|CDX96273.1| BnaA07g28840D [Brassica napus] 66 1e-08 emb|CDY11551.1| BnaC06g31880D [Brassica napus] 66 1e-08 ref|XP_002888792.1| kinase family protein [Arabidopsis lyrata su... 65 1e-08 ref|XP_011078341.1| PREDICTED: putative receptor-like protein ki... 65 2e-08 ref|XP_008464706.1| PREDICTED: putative receptor-like protein ki... 65 2e-08 ref|XP_008464705.1| PREDICTED: putative receptor-like protein ki... 65 2e-08 gb|AAG52342.1|AC011663_21 putative protein kinase; 29119-30743 [... 65 2e-08 ref|NP_177231.2| protein kinase family protein [Arabidopsis thal... 65 2e-08 ref|XP_006390845.1| hypothetical protein EUTSA_v10018598mg [Eutr... 65 2e-08 dbj|BAC42109.1| putative protein kinase [Arabidopsis thaliana] 65 2e-08 ref|NP_001185366.1| protein kinase family protein [Arabidopsis t... 65 2e-08 ref|XP_003631201.1| PREDICTED: cysteine-rich receptor-like prote... 65 2e-08 emb|CAN71621.1| hypothetical protein VITISV_016299 [Vitis vinifera] 65 2e-08 ref|XP_007158801.1| hypothetical protein PHAVU_002G182900g [Phas... 65 2e-08 >ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223532820|gb|EEF34595.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Length = 411 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC QGDP+LRP+M+RV +LLSK+ GNLEEPSRPG GS YR S Sbjct: 302 LLCTQGDPQLRPNMRRVVILLSKRPGNLEEPSRPGVPGSRYRRS 345 >emb|CDP00812.1| unnamed protein product [Coffea canephora] Length = 400 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLCVQ DP+LRP M+RV V+LS+K G LEEP+RPGY GS YR S Sbjct: 301 LLCVQSDPRLRPKMRRVVVMLSRKPGTLEEPTRPGYPGSRYRKS 344 >ref|XP_004297467.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Fragaria vesca subsp. vesca] Length = 428 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLCVQGDP++RP+M RV V+LSKK NLEEPSRPG GS YR S Sbjct: 302 LLCVQGDPQVRPAMHRVVVILSKKPSNLEEPSRPGLPGSRYRRS 345 >ref|XP_008221435.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 35 [Prunus mume] Length = 394 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC+QGDP+LRP+M RV V+LSKK NLEEP+RPG GS YR S Sbjct: 302 LLCIQGDPQLRPTMHRVVVILSKKPSNLEEPTRPGVPGSRYRRS 345 >ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica] gi|462419942|gb|EMJ24205.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica] Length = 394 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC+QGDP+LRP+M RV V+LSKK NLEEP+RPG GS YR S Sbjct: 302 LLCIQGDPQLRPTMHRVVVILSKKPSNLEEPTRPGVPGSRYRRS 345 >ref|XP_009105741.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brassica rapa] Length = 428 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RP+M+RVS+LLS+K G+LEEP RPG GS YR T Sbjct: 312 LLCVQGDPHQRPAMRRVSLLLSRKPGHLEEPERPGVPGSRYRRRT 356 >emb|CDX96273.1| BnaA07g28840D [Brassica napus] Length = 428 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RP+M+RVS+LLS+K G+LEEP RPG GS YR T Sbjct: 312 LLCVQGDPHQRPAMRRVSLLLSRKPGHLEEPERPGVPGSRYRRRT 356 >emb|CDY11551.1| BnaC06g31880D [Brassica napus] Length = 428 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RP+M+RVS+LLS+K G+LEEP RPG GS YR T Sbjct: 312 LLCVQGDPHQRPAMRRVSLLLSRKPGHLEEPERPGVPGSRYRRRT 356 >ref|XP_002888792.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297334633|gb|EFH65051.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 410 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RPSM+RVS+LLS+K G+LEEP PG GS YR T Sbjct: 297 LLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRQT 341 >ref|XP_011078341.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Sesamum indicum] Length = 396 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNL-EEPSRPGYHGSSYR 336 LLCVQ DPK RP M RV V+LSKKH N+ EEP+RPGY GS YR Sbjct: 303 LLCVQSDPKSRPDMDRVVVMLSKKHSNIVEEPTRPGYSGSRYR 345 >ref|XP_008464706.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X2 [Cucumis melo] Length = 411 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC QGDP LRP+M RV ++LSK+ GNLEEP+RPG GS YR S Sbjct: 302 LLCTQGDPHLRPTMPRVVLILSKRPGNLEEPTRPGIPGSRYRRS 345 >ref|XP_008464705.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Cucumis melo] Length = 412 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC QGDP LRP+M RV ++LSK+ GNLEEP+RPG GS YR S Sbjct: 303 LLCTQGDPHLRPTMPRVVLILSKRPGNLEEPTRPGIPGSRYRRS 346 >gb|AAG52342.1|AC011663_21 putative protein kinase; 29119-30743 [Arabidopsis thaliana] Length = 381 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RPSM+RVS+LLS+K G+LEEP PG GS YR T Sbjct: 268 LLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRT 312 >ref|NP_177231.2| protein kinase family protein [Arabidopsis thaliana] gi|193870477|gb|ACF22895.1| At1g70740 [Arabidopsis thaliana] gi|332196987|gb|AEE35108.1| protein kinase family protein [Arabidopsis thaliana] Length = 425 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RPSM+RVS+LLS+K G+LEEP PG GS YR T Sbjct: 312 LLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRT 356 >ref|XP_006390845.1| hypothetical protein EUTSA_v10018598mg [Eutrema salsugineum] gi|557087279|gb|ESQ28131.1| hypothetical protein EUTSA_v10018598mg [Eutrema salsugineum] Length = 427 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RP M+RVS+LLS+K G+LEEP RPG GS YR T Sbjct: 312 LLCVQGDPHQRPPMRRVSLLLSRKPGHLEEPERPGVPGSRYRRRT 356 >dbj|BAC42109.1| putative protein kinase [Arabidopsis thaliana] Length = 159 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RPSM+RVS+LLS+K G+LEEP PG GS YR T Sbjct: 46 LLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRT 90 >ref|NP_001185366.1| protein kinase family protein [Arabidopsis thaliana] gi|332196988|gb|AEE35109.1| protein kinase family protein [Arabidopsis thaliana] Length = 425 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSST 327 LLCVQGDP RPSM+RVS+LLS+K G+LEEP PG GS YR T Sbjct: 312 LLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPGVPGSRYRRRT 356 >ref|XP_003631201.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis vinifera] gi|297737665|emb|CBI26866.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC Q DP+ RP+M+RV V+LSKK G LEEP+RPGY GS YR S Sbjct: 310 LLCTQADPQSRPNMRRVVVMLSKKPGTLEEPTRPGYPGSRYRRS 353 >emb|CAN71621.1| hypothetical protein VITISV_016299 [Vitis vinifera] Length = 437 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYRSS 330 LLC Q DP+ RP+M+RV V+LSKK G LEEP+RPGY GS YR S Sbjct: 345 LLCTQADPQSRPNMRRVVVMLSKKPGTLEEPTRPGYPGSRYRRS 388 >ref|XP_007158801.1| hypothetical protein PHAVU_002G182900g [Phaseolus vulgaris] gi|561032216|gb|ESW30795.1| hypothetical protein PHAVU_002G182900g [Phaseolus vulgaris] Length = 406 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 461 LLCVQGDPKLRPSMQRVSVLLSKKHGNLEEPSRPGYHGSSYR 336 LLC QGDP+LRPSM+RV V+LS+K G ++EPSRPG GS YR Sbjct: 308 LLCTQGDPQLRPSMRRVVVMLSRKPGQMQEPSRPGVPGSRYR 349