BLASTX nr result
ID: Cinnamomum25_contig00025192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00025192 (533 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510452.1| pentatricopeptide repeat-containing protein,... 92 2e-16 ref|XP_010256333.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 gb|KHG27004.1| Pentatricopeptide repeat-containing -like protein... 84 4e-14 gb|KJB58186.1| hypothetical protein B456_009G198200 [Gossypium r... 83 6e-14 gb|KJB58185.1| hypothetical protein B456_009G198200 [Gossypium r... 83 6e-14 ref|XP_012445135.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfam... 82 1e-13 ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128... 81 2e-13 ref|XP_008221342.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_012071943.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_009335755.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_008387999.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_006435073.1| hypothetical protein CICLE_v10000229mg [Citr... 73 8e-11 ref|XP_003615696.1| Pentatricopeptide repeat-containing protein ... 73 8e-11 ref|XP_010664949.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_011650192.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 gb|KGN62635.1| hypothetical protein Csa_2G362480 [Cucumis sativus] 72 2e-10 ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_008444757.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 >ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551153|gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1218 Score = 91.7 bits (226), Expect = 2e-16 Identities = 46/89 (51%), Positives = 65/89 (73%) Frame = -3 Query: 276 PMASKTALPSLPNKHETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTA 97 P+ K+ + S+PN+ +TL+ F +KP K S T KITD +L +LC+ GRL EAV+A Sbjct: 7 PIIKKSPI-SIPNEQDTLSAFSTKPTKSSVPFTK----KITDSHLNYLCKKGRLNEAVSA 61 Query: 96 IDLLAESGSKVRPKTYISLLQSCIDLDSI 10 ++L+A+ GSKV PKT+ISLLQSCID +S+ Sbjct: 62 LELIAQHGSKVSPKTFISLLQSCIDCNSV 90 >ref|XP_010256333.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nelumbo nucifera] Length = 898 Score = 86.7 bits (213), Expect = 6e-15 Identities = 44/69 (63%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -3 Query: 213 PSKPN-KESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVRPKTYISLL 37 PS P+ K ++ SE P+IT+ +L HLCRNG+LKEAV+A+D +A+ GSKV PKTYISLL Sbjct: 33 PSIPSSKVPKKVASETAPRITEFHLNHLCRNGQLKEAVSALDSIAKRGSKVGPKTYISLL 92 Query: 36 QSCIDLDSI 10 QSCID+DSI Sbjct: 93 QSCIDMDSI 101 >gb|KHG27004.1| Pentatricopeptide repeat-containing -like protein [Gossypium arboreum] Length = 714 Score = 84.0 bits (206), Expect = 4e-14 Identities = 42/81 (51%), Positives = 56/81 (69%), Gaps = 1/81 (1%) Frame = -3 Query: 246 LPNKHETLAQFPSKPNKESTELTSE-KPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGS 70 +P KH+ L++F P K S T PKITD ++ +L R+GRL EAV A+D +A SGS Sbjct: 16 IPTKHDNLSEFSQPPTKLSFTYTKNTNNPKITDNHVKYLARSGRLAEAVAALDSIALSGS 75 Query: 69 KVRPKTYISLLQSCIDLDSID 7 +VRP T+ISLLQ+CID S+D Sbjct: 76 QVRPNTFISLLQACIDFGSLD 96 >gb|KJB58186.1| hypothetical protein B456_009G198200 [Gossypium raimondii] Length = 1512 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/81 (51%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -3 Query: 246 LPNKHETLAQFPSKPNKESTELT-SEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGS 70 +P KH+ L++F K S T + K PKITD ++ +L R+GRL EAV A+D +A SGS Sbjct: 16 IPTKHDNLSEFSQPQTKLSFTYTKNNKNPKITDNHVKYLARSGRLAEAVAALDSIALSGS 75 Query: 69 KVRPKTYISLLQSCIDLDSID 7 +VRP T+ISLLQ+CID S+D Sbjct: 76 QVRPNTFISLLQACIDFGSLD 96 >gb|KJB58185.1| hypothetical protein B456_009G198200 [Gossypium raimondii] Length = 1244 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/81 (51%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -3 Query: 246 LPNKHETLAQFPSKPNKESTELT-SEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGS 70 +P KH+ L++F K S T + K PKITD ++ +L R+GRL EAV A+D +A SGS Sbjct: 16 IPTKHDNLSEFSQPQTKLSFTYTKNNKNPKITDNHVKYLARSGRLAEAVAALDSIALSGS 75 Query: 69 KVRPKTYISLLQSCIDLDSID 7 +VRP T+ISLLQ+CID S+D Sbjct: 76 QVRPNTFISLLQACIDFGSLD 96 >ref|XP_012445135.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Gossypium raimondii] gi|763791188|gb|KJB58184.1| hypothetical protein B456_009G198200 [Gossypium raimondii] Length = 890 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/81 (51%), Positives = 57/81 (70%), Gaps = 1/81 (1%) Frame = -3 Query: 246 LPNKHETLAQFPSKPNKESTELT-SEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGS 70 +P KH+ L++F K S T + K PKITD ++ +L R+GRL EAV A+D +A SGS Sbjct: 16 IPTKHDNLSEFSQPQTKLSFTYTKNNKNPKITDNHVKYLARSGRLAEAVAALDSIALSGS 75 Query: 69 KVRPKTYISLLQSCIDLDSID 7 +VRP T+ISLLQ+CID S+D Sbjct: 76 QVRPNTFISLLQACIDFGSLD 96 >ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590593723|ref|XP_007017650.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722977|gb|EOY14874.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722978|gb|EOY14875.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 890 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/81 (49%), Positives = 58/81 (71%), Gaps = 1/81 (1%) Frame = -3 Query: 246 LPNKHETLAQFPSKPNKESTELTSE-KPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGS 70 +P KHE L++F P K + T + PKI+D +L +L RNGRL EA+TA+D +A+SGS Sbjct: 16 IPTKHENLSEFSQTPTKLAFSNTKKTNNPKISDSHLNYLSRNGRLTEAITALDSIAQSGS 75 Query: 69 KVRPKTYISLLQSCIDLDSID 7 +VR T+I+LLQ+CID S++ Sbjct: 76 QVRANTFINLLQACIDFGSLE 96 >ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128794 isoform X2 [Populus euphratica] Length = 1277 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/78 (48%), Positives = 53/78 (67%) Frame = -3 Query: 240 NKHETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVR 61 +K E+L++F KP K S PK D +L LC+NG L +AVT +D +A+ GSKV Sbjct: 19 SKQESLSEFSQKPIKSSISFAKNPLPKFIDSHLDSLCKNGSLNDAVTVLDSVAQQGSKVT 78 Query: 60 PKTYISLLQSCIDLDSID 7 P+TY++LLQSCID +SI+ Sbjct: 79 PRTYMNLLQSCIDTNSIN 96 >ref|XP_008221342.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Prunus mume] Length = 889 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/89 (43%), Positives = 55/89 (61%) Frame = -3 Query: 276 PMASKTALPSLPNKHETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTA 97 P S P LP+K ++F + K + + PK TD +L +LC+NGR EA+T Sbjct: 7 PCKSSPPTPILPSKLGNPSEFSLRHAKPIISFSRKTLPKFTDTHLNYLCKNGRFSEAITV 66 Query: 96 IDLLAESGSKVRPKTYISLLQSCIDLDSI 10 +D +A+ GSKV P TY++LLQSCID +SI Sbjct: 67 LDSIAQIGSKVPPTTYMNLLQSCIDTNSI 95 >ref|XP_012071943.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Jatropha curcas] Length = 889 Score = 77.8 bits (190), Expect = 3e-12 Identities = 39/76 (51%), Positives = 54/76 (71%) Frame = -3 Query: 240 NKHETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVR 61 NK +T + SKP K S T + KI+D +L +LC+NGRL EAVTA++ +A+ G KVR Sbjct: 18 NKQDTPSICSSKPAKSSVPFTKKLHCKISDSHLNYLCQNGRLSEAVTALESIAQHGFKVR 77 Query: 60 PKTYISLLQSCIDLDS 13 KT+I+L+QSCID +S Sbjct: 78 SKTFINLIQSCIDSNS 93 >ref|XP_009335755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Pyrus x bretschneideri] Length = 862 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/89 (41%), Positives = 56/89 (62%) Frame = -3 Query: 276 PMASKTALPSLPNKHETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTA 97 P S + +P +P+K ++F + K + + + PK TD +L +L +NG EAVT Sbjct: 7 PCKSSSPIPMVPSKFSNPSKFLPRQTKPTMSFSRKTLPKFTDSHLNYLRKNGEFTEAVTV 66 Query: 96 IDLLAESGSKVRPKTYISLLQSCIDLDSI 10 +D +A+SGSKV TY++LLQSCID +SI Sbjct: 67 LDSIAKSGSKVTSTTYMNLLQSCIDTNSI 95 >ref|XP_008387999.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Malus domestica] Length = 851 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/89 (41%), Positives = 55/89 (61%) Frame = -3 Query: 276 PMASKTALPSLPNKHETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTA 97 P S +P +P+K ++F + K + + + PK TD +L +L +NG EAVT Sbjct: 7 PCKSSPPIPIVPSKFSNPSEFLPRQTKPTISFSRKTLPKFTDSHLNYLRKNGEFTEAVTV 66 Query: 96 IDLLAESGSKVRPKTYISLLQSCIDLDSI 10 +D +A+SGSKV TY++LLQSCID +SI Sbjct: 67 LDSIAKSGSKVTSTTYMNLLQSCIDTNSI 95 >ref|XP_006435073.1| hypothetical protein CICLE_v10000229mg [Citrus clementina] gi|557537195|gb|ESR48313.1| hypothetical protein CICLE_v10000229mg [Citrus clementina] Length = 889 Score = 72.8 bits (177), Expect = 8e-11 Identities = 40/92 (43%), Positives = 56/92 (60%), Gaps = 3/92 (3%) Frame = -3 Query: 276 PMASKTALPSL-PNKH--ETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEA 106 P S + LP + P KH ++ + F N + LT + P+ D +L LC NGRL EA Sbjct: 3 PCMSVSKLPVIIPQKHKPDSSSGFSPHSNNYTRSLTKKSNPRFRDTHLDFLCGNGRLNEA 62 Query: 105 VTAIDLLAESGSKVRPKTYISLLQSCIDLDSI 10 +T +D +A G+KVR TYI+LLQ+CID +SI Sbjct: 63 ITVLDSIATQGAKVRRNTYINLLQACIDSNSI 94 >ref|XP_003615696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517031|gb|AES98654.1| PPR containing plant-like protein [Medicago truncatula] Length = 887 Score = 72.8 bits (177), Expect = 8e-11 Identities = 42/92 (45%), Positives = 53/92 (57%), Gaps = 13/92 (14%) Frame = -3 Query: 246 LPNKHETLAQFPSKPNK-----------ESTELTSEKPP--KITDQYLLHLCRNGRLKEA 106 +PNK T FP+KP K S +++ KP K+ D L LC NG L EA Sbjct: 8 IPNKSITPLSFPNKPTKFDCISSKRVNANSNNVSTTKPSIRKLIDSQLNQLCINGSLSEA 67 Query: 105 VTAIDLLAESGSKVRPKTYISLLQSCIDLDSI 10 VT +D LAE G +V+P TY++LLQSCID D I Sbjct: 68 VTILDSLAEQGCRVKPITYMNLLQSCIDKDCI 99 >ref|XP_010664949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Vitis vinifera] Length = 1593 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -3 Query: 183 LTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVRPKTYISLLQSCIDLDSID 7 LT + PK+TD +L HLC+NGRL +A+ +D +A+ GS V+P TY+ LLQSCID S + Sbjct: 44 LTPKLKPKVTDAHLNHLCKNGRLADAIACLDAIAQGGSNVKPNTYMQLLQSCIDQGSAE 102 >ref|XP_011650192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Cucumis sativus] Length = 1514 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/71 (49%), Positives = 49/71 (69%) Frame = -3 Query: 219 QFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVRPKTYISL 40 +F SKP K S T + K D +L +LC NG L+EA+TAID +++ GSK+ TYI+L Sbjct: 27 KFSSKPIKTSIFFTYKLTSKFNDDHLSYLCSNGLLREAITAIDSISKRGSKLSTNTYINL 86 Query: 39 LQSCIDLDSID 7 LQ+CID+ SI+ Sbjct: 87 LQTCIDVGSIE 97 >gb|KGN62635.1| hypothetical protein Csa_2G362480 [Cucumis sativus] Length = 890 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/71 (49%), Positives = 49/71 (69%) Frame = -3 Query: 219 QFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVRPKTYISL 40 +F SKP K S T + K D +L +LC NG L+EA+TAID +++ GSK+ TYI+L Sbjct: 27 KFSSKPIKTSIFFTYKLTSKFNDDHLSYLCSNGLLREAITAIDSISKRGSKLSTNTYINL 86 Query: 39 LQSCIDLDSID 7 LQ+CID+ SI+ Sbjct: 87 LQTCIDVGSIE 97 >ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X2 [Citrus sinensis] Length = 1252 Score = 71.2 bits (173), Expect = 2e-10 Identities = 39/92 (42%), Positives = 55/92 (59%), Gaps = 3/92 (3%) Frame = -3 Query: 276 PMASKTALPSL-PNKH--ETLAQFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEA 106 P S + LP + P KH ++ + F N + T + P+ D +L LC NGRL EA Sbjct: 3 PCMSVSKLPVIIPQKHKPDSSSGFSPHSNNSTRSWTKKSNPRFRDTHLDFLCGNGRLNEA 62 Query: 105 VTAIDLLAESGSKVRPKTYISLLQSCIDLDSI 10 +T +D +A G+KVR TYI+LLQ+CID +SI Sbjct: 63 ITVLDSIATQGAKVRRNTYINLLQACIDSNSI 94 >ref|XP_008444757.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Cucumis melo] Length = 890 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/71 (49%), Positives = 48/71 (67%) Frame = -3 Query: 219 QFPSKPNKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVRPKTYISL 40 +F SKP K S T + K D +L +LC NG L+EA+TAID +++ GSK+ TYI+L Sbjct: 27 KFSSKPIKTSVFFTYKLTSKSNDDHLSYLCSNGLLREAITAIDSMSKRGSKLSTNTYINL 86 Query: 39 LQSCIDLDSID 7 LQ+CID SI+ Sbjct: 87 LQTCIDAGSIE 97 >ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Cicer arietinum] Length = 888 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/64 (53%), Positives = 41/64 (64%) Frame = -3 Query: 201 NKESTELTSEKPPKITDQYLLHLCRNGRLKEAVTAIDLLAESGSKVRPKTYISLLQSCID 22 N + +T PK+ D L LC NG L E VT +D +AE GSKVRP TY++LLQSCID Sbjct: 37 NSNNVSITKTSNPKLMDAQLNQLCINGSLSEVVTYLDAIAEQGSKVRPITYMNLLQSCID 96 Query: 21 LDSI 10 D I Sbjct: 97 KDCI 100